Sorcin/SRI Protein, Human (sf9, His-GST)
Based on 1 Customer Validation
The Sorcin/SRI protein is a calcium-binding regulator that complexly regulates excitation-contraction coupling in the heart and plays a critical role in maintaining calcium homeostasis within the sarcoplasmic reticulum. As a homodimer, Sorcin/SRI affects the activity of the RYR2 calcium channel, helping to precisely control calcium dynamics in cardiomyocytes. Sorcin/SRI Protein, Human (sf9, His-GST) is the recombinant human-derived Sorcin/SRI protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The Sorcin/SRI protein is a calcium-binding regulator that complexly regulates excitation-contraction coupling in the heart and plays a critical role in maintaining calcium homeostasis within the sarcoplasmic reticulum. As a homodimer, Sorcin/SRI affects the activity of the RYR2 calcium channel, helping to precisely control calcium dynamics in cardiomyocytes. Sorcin/SRI Protein, Human (sf9, His-GST) is the recombinant human-derived Sorcin/SRI protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.
Background
Sorcin (SRI) is a calcium-binding protein crucial for regulating excitation-contraction coupling in the heart, playing a significant role in maintaining calcium homeostasis within the sarcoplasmic reticulum. SRI has been identified as a modulator of RYR2 calcium channels, suggesting its involvement in finely tuning intracellular calcium dynamics. Existing as a homodimer, SRI also engages in protein-protein interactions, forming complexes with GCA, RYR2, and ANXA7. It has to underscore SRI's importance in modulating calcium signaling and excitation-contraction coupling in cardiac muscle, providing insights into its multifaceted role in cardiac physiology and its interactions with key regulatory proteins.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag N-His;N-GST
-
Accession
P30626 (M1-V198)
-
Molecular Construction
-
N-term
-
His-GST
-
SRI (M1-V198)
Accession # P30626 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
SRI; CP22; Sorcin; V19; Calcium Binding Protein Amplified In Mutlidrug-Resistant Cells; H_RG167B05.1; 22 KDa Protein; SCN; CP-22
-
AA Sequence
MAYPGHPGAGGGYYPGGYGGAPGGPAFPGQTQDPLYGYFAAVAGQDGQIDADELQRCLTQSGIAGGYKPFNLETCRLMVSMLDRDMSGTMGFNEFKELWAVLNGWRQHFISFDTDRSGTVDPQELQKALTTMGFRLSPQAVNSIAKRYSTNGKITFDDYIACCVKLRALTDSFRRRDTAQQGVVNFPYDDFIQCVMSV
-
Predicted Molecular Mass
49.5 kDa
-
Molecular Weight
Approximately 47 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 20 mM Tris, 500 mM NaCl, pH 7.4, 10% glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
