SPINK1 Protein, Human (HEK293, His)

The SPINK1 protein is a serine protease inhibitor that significantly inhibits trypsin, especially in the pancreas, preventing premature activation of the zymogen. This critical role maintains the integrity of pancreatic cellular processes. SPINK1 Protein, Human (HEK293, His) is the recombinant human-derived SPINK1 protein, expressed by HEK293 , with C-6*His labeled tag.

SPINK1, a serine protease inhibitor, demonstrates notable anti-trypsin activity, particularly in the pancreas where it serves a critical role in safeguarding against premature activation of zymogens catalyzed by trypsin. This protective function helps maintain the integrity of cellular processes within the pancreas. Additionally, SPINK1 exhibits involvement in the male reproductive tract, where it binds to sperm heads, exerting its influence on sperm capacitance. Notably, SPINK1 achieves this modulation by inhibiting calcium uptake and nitrogen oxide (NO) production, showcasing its diverse regulatory functions in distinct physiological contexts.

Human

HEK293

C-6*His

P00995 (D24-C79)

6690  [NCBI]

Full Length of Mature Protein

DSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILIQKSGPC

Approximately 12-16 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl, 500 mM NaCl, 5% trehalose, 5% Mannitol, 0.02% Tween 80, pH 9.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.