STUB1 Protein, Human (His)
Based on 1 Customer Validation
STUB1 protein is an E3 ubiquitin protein ligase that cooperates with ATXN3 to regulate ubiquitin chain length on substrates and prevent chain extension. It ubiquitinates NOS1 through Hsp70/Hsp40 and regulates chaperone complexes (Hsp70, Hsc70, Hsp90). STUB1 Protein, Human (His) is the recombinant human-derived STUB1 protein, expressed by E. coli , with His tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
STUB1 protein is an E3 ubiquitin protein ligase that cooperates with ATXN3 to regulate ubiquitin chain length on substrates and prevent chain extension. It ubiquitinates NOS1 through Hsp70/Hsp40 and regulates chaperone complexes (Hsp70, Hsc70, Hsp90). STUB1 Protein, Human (His) is the recombinant human-derived STUB1 protein, expressed by E. coli , with His tag.
Background
STUB1 Protein, an E3 ubiquitin-protein ligase, plays a pivotal role in targeting misfolded chaperone substrates for proteasomal degradation, collaborating with ATXN3 to regulate the ubiquitin chain length attached to STUB1 substrates and prevent further chain extension. It ubiquitinates NOS1 in conjunction with Hsp70 and Hsp40, modulating the activity of key chaperone complexes such as Hsp70, Hsc70, and Hsp90. Additionally, STUB1 mediates the transfer of non-canonical short ubiquitin chains to HSPA8 without affecting its degradation. The protein is involved in base-excision repair by catalyzing polyubiquitination of DNA polymerase beta (POLB), amplifying the HUWE1/ARF-BP1-dependent monoubiquitination and leading to POLB degradation. STUB1 also participates in the polyubiquitination of CYP3A4, ubiquitinates EPHA2 to potentially regulate receptor stability, acts as a co-chaperone for HSPA1A and HSPA1B, and negatively regulates TGF-beta signaling by modulating SMAD3 levels via ubiquitin-mediated degradation. Furthermore, STUB1 contributes to the degradation of FOXP3, SIRT6, and RIPK3, and likely downregulates PD-L1/CD274 plasma membrane expression. Its diverse functions underscore its significance in cellular homeostasis and immune regulation.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-6*His
-
Accession
Q9UNE7-1 (M1-Y303)
-
Gene ID10273
-
Molecular Construction
-
N-term
-
STUB1 (M1-Y303)
Accession # Q9UNE7 -
6*His
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
STUB1; CLL-Associated Antigen KW-8; STIP1 Homology And U-Box Containing Protein 1; Antigen NY-CO-7; CHIP; STIP1 Homology And U-Box Containing Protein 1, E3 Ubiquitin Protein Ligase; SDCCAG7; Heat Shock Protein A Binding Protein 2 (C-Terminal); HSPABP2; ST
-
AA Sequence
MKGKEEKEGGARLGAGGGSPEKSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQHEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERRIHQESELHSYLSRLIAAERERELEECQRNHEGDEDDSHVRAQQACIEAKHDKYMADMDELFSQVDEKRKKRDIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQEQLIPNLAMKEVIDAFISENGWVEDY
-
Predicted Molecular Mass
41.8 kDa
-
Molecular Weight
Approximately 45 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O . For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)