Syntenin-1 Protein, Human (N-His)
Based on 1 Customer Validation
Syntenin-1 protein is known to mediate Syndecan signaling and has a PDZ domain that binds transmembrane proteins. It affects cytoskeletal membrane organization, cell adhesion, protein trafficking, and transcription factor activation. Syntenin-1 Protein, Human (N-His) is the recombinant human-derived Syntenin-1 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Syntenin-1 protein is known to mediate Syndecan signaling and has a PDZ domain that binds transmembrane proteins. It affects cytoskeletal membrane organization, cell adhesion, protein trafficking, and transcription factor activation. Syntenin-1 Protein, Human (N-His) is the recombinant human-derived Syntenin-1 protein, expressed by E. coli , with N-6*His labeled tag.
Background
Syntenin-1 Protein, initially recognized as a mediator linking syndecan-mediated signaling to the cytoskeleton, is characterized by tandemly repeated PDZ domains capable of binding the cytoplasmic, C-terminal domains of various transmembrane proteins. Beyond its role in syndecan signaling, syntenin-1 is implicated in influencing cytoskeletal-membrane organization, cell adhesion, protein trafficking, and the activation of transcription factors. While primarily localized to membrane-associated adherens junctions and focal adhesions, this protein is also present in the endoplasmic reticulum and nucleus. Alternative splicing generates multiple transcript variants encoding diverse isoforms. Furthermore, related pseudogenes have been identified on multiple chromosomes. With ubiquitous expression observed in placenta (RPKM 77.0), gall bladder (RPKM 73.7), and 25 other tissues, syntenin-1's wide-ranging presence underscores its involvement in diverse cellular processes across various tissues.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
NP_001007068.1 (M1-V298)
-
Molecular Construction
-
N-term
-
6*His
-
Syntenin-1 (M1-V298)
Accession # NP_001007068.1 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
SDCBP; TACIP18; Syndecan Binding Protein; MDA9; MDA-9; CDNA FLJ55055, Moderately Similar To Syntenin-1; SYCL; Melanoma Differentiation Associated Protein-9; Syntenin-1; Melanoma Differentiation-Associated Protein 9; SDCBP1; Syndecan Binding Protein (Synte
-
AA Sequence
MSLYPSLEDLKVDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGAPLQGQLVARPSSINYMVAPVTGNDVGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPAFIFEHIIKRMAPSIMKSLMDHTIPEV
-
Predicted Molecular Mass
33 kDa
-
Molecular Weight
Approximately 32 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
