Testin Protein, Human (His)
Testin protein is a scaffold protein that plays multiple roles in cell adhesion, spreading, and actin cytoskeleton reorganization. Testin is involved in the regulation of cell proliferation and acts as a tumor suppressor, inhibiting the growth of tumor cells. Testin Protein, Human (His) is the recombinant human-derived Testin, expressed by E. coli, with C-6*His labeled tag.
- Species: Human
- Source: E. coli
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Testin protein is a scaffold protein that plays multiple roles in cell adhesion, spreading, and actin cytoskeleton reorganization. Testin is involved in the regulation of cell proliferation and acts as a tumor suppressor, inhibiting the growth of tumor cells. Testin Protein, Human (His) is the recombinant human-derived Testin, expressed by E. coli, with C-6*His labeled tag.
Testin, a scaffold protein, is implicated in diverse cellular processes, including cell adhesion, cell spreading, and the reorganization of the actin cytoskeleton. With a potential role in regulating cell proliferation, Testin has been identified as a tumor suppressor, exerting inhibitory effects on tumor cell growth. Notably, Testin interacts with various proteins to exert its functions, including ZYX through LIM domain 1, ENAH and VASP via LIM domain 3, ALKBH4, talin, actin, alpha-actinin, GRIP1, and PXN. Furthermore, Testin forms a heterodimer with ACTL7A, and this heterodimer, in conjunction with ENAH, assembles into a heterotrimer, revealing the intricate network of interactions contributing to Testin's multifaceted roles in cellular dynamics and potential tumor-suppressive functions.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-6*His
-
Accession
Q9UGI8 (M1-S421)
-
Molecular Construction
-
N-term
-
Testin (M1-S421)
Accession # Q9UGI8 -
6*His
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
TES; DKFZP586B2022; Testin LIM Domain Protein; Testin; TESS-2; TESS; TESTIN; Testin Variant; Testis Derived Transcript (3 LIM Domains)
-
AA Sequence
MDLENKVKKMGLGHEQGFGAPCLKCKEKCEGFELHFWRKICRNCKCGQEEHDVLLSNEEDRKVGKLFEDTKYTTLIAKLKSDGIPMYKRNVMILTNPVAAKKNVSINTVTYEWAPPVQNQALARQYMQMLPKEKQPVAGSEGAQYRKKQLAKQLPAHDQDPSKCHELSPREVKEMEQFVKKYKSEALGVGDVKLPCEMDAQGPKQMNIPGGDRSTPAAVGAMEDKSAEHKRTQYSCYCCKLSMKEGDPAIYAERAGYDKLWHPACFVCSTCHELLVDMIYFWKNEKLYCGRHYCDSEKPRCAGCDELIFSNEYTQAENQNWHLKHFCCFDCDSILAGEIYVMVNDKPVCKPCYVKNHAVVCQGCHNAIDPEVQRVTYNNFSWHASTECFLCSCCSKCLIGQKFMPVEGMVFCSVECKKRMS
-
Predicted Molecular Mass
49.1 KDa
-
Molecular Weight
Approximately 50 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
