Testin Protein, Human (His)

Testin protein is a scaffold protein that plays multiple roles in cell adhesion, spreading, and actin cytoskeleton reorganization. Testin is involved in the regulation of cell proliferation and acts as a tumor suppressor, inhibiting the growth of tumor cells. Testin Protein, Human (His) is the recombinant human-derived Testin, expressed by E. coli, with C-6*His labeled tag.

Testin, a scaffold protein, is implicated in diverse cellular processes, including cell adhesion, cell spreading, and the reorganization of the actin cytoskeleton. With a potential role in regulating cell proliferation, Testin has been identified as a tumor suppressor, exerting inhibitory effects on tumor cell growth. Notably, Testin interacts with various proteins to exert its functions, including ZYX through LIM domain 1, ENAH and VASP via LIM domain 3, ALKBH4, talin, actin, alpha-actinin, GRIP1, and PXN. Furthermore, Testin forms a heterodimer with ACTL7A, and this heterodimer, in conjunction with ENAH, assembles into a heterotrimer, revealing the intricate network of interactions contributing to Testin's multifaceted roles in cellular dynamics and potential tumor-suppressive functions.

Human

E. coli

C-6*His

Q9UGI8 (M1-S421)

26136  [NCBI]

Full Length

MDLENKVKKMGLGHEQGFGAPCLKCKEKCEGFELHFWRKICRNCKCGQEEHDVLLSNEEDRKVGKLFEDTKYTTLIAKLKSDGIPMYKRNVMILTNPVAAKKNVSINTVTYEWAPPVQNQALARQYMQMLPKEKQPVAGSEGAQYRKKQLAKQLPAHDQDPSKCHELSPREVKEMEQFVKKYKSEALGVGDVKLPCEMDAQGPKQMNIPGGDRSTPAAVGAMEDKSAEHKRTQYSCYCCKLSMKEGDPAIYAERAGYDKLWHPACFVCSTCHELLVDMIYFWKNEKLYCGRHYCDSEKPRCAGCDELIFSNEYTQAENQNWHLKHFCCFDCDSILAGEIYVMVNDKPVCKPCYVKNHAVVCQGCHNAIDPEVQRVTYNNFSWHASTECFLCSCCSKCLIGQKFMPVEGMVFCSVECKKRMS

Approximately 50 kDa, based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.