Thrombin Receptor/PAR1 Protein, Human (HEK293, His)
Based on 1 Customer Validation
The thrombin receptor/PAR1 protein is a high-affinity receptor for activated thrombin that is coupled to G proteins to stimulate phosphoinositide hydrolysis. This signaling mechanism suggests its involvement in platelet activation, which is critical for hemostasis and thrombosis. Thrombin Receptor/PAR1 Protein, Human (HEK293, His) is the recombinant human-derived Thrombin Receptor/PAR1 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The thrombin receptor/PAR1 protein is a high-affinity receptor for activated thrombin that is coupled to G proteins to stimulate phosphoinositide hydrolysis. This signaling mechanism suggests its involvement in platelet activation, which is critical for hemostasis and thrombosis. Thrombin Receptor/PAR1 Protein, Human (HEK293, His) is the recombinant human-derived Thrombin Receptor/PAR1 protein, expressed by HEK293 , with C-His labeled tag.
Background
Thrombin Receptor/PAR1 Protein serves as a high-affinity receptor for activated thrombin, forming a coupling with G proteins that, in turn, stimulate phosphoinositide hydrolysis. This intricate signaling mechanism suggests its potential involvement in platelet activation, a critical process in hemostasis and thrombosis. Furthermore, Thrombin Receptor/PAR1 Protein may play a role in vascular development, indicating its significance in the complex regulatory pathways that govern blood vessel formation and maintenance. The dual functions of this receptor highlight its role in both hemostatic processes and broader aspects of vascular biology, underscoring its importance in maintaining cardiovascular homeostasis.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
P25116/NP_001983.2 (A22-T102)
-
Molecular Construction
-
N-term
-
PAR1 (A22-T102)
Accession # P25116/NP_001983.2 -
His
-
C-term
-
-
Protein Length
Partial Extracellular Domain (with Propeptide)
-
Synonyms
F2R; Coagulation Factor II (Thrombin) Receptor, Isoform CRA_b; Coagulation Factor II Thrombin Receptor; Coagulation Factor II (Thrombin) Receptor; PAR-1; Coagulation Factor II Receptor; PAR1; Protease Activated Receptor 1; CF2R; Protease-Activated Recepto
-
AA Sequence
ARTRARRPESKATNATLDPRSFLLRNPNDKYEPFWEDEEKNESGLTEYRLVSINKSSPLQKQLPAFISEDASGYLTSSWLT
-
Molecular Weight
Approximately 22-37 kDa due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
