TIMP-1 Protein, Mouse (HEK293)
Based on 1 publication(s) in Google Scholar
TIMP-1 is a metalloproteinase inhibitor that irreversibly inactivates collagenase and other metalloproteinases by binding to their catalytic zinc cofactor.It regulates MMP1, MMP2, MMP3, MMP7, MMP8, MMP9, MMP10, MMP11, MMP12, MMP13 and MMP16 and affects cellular processes such as differentiation, migration and cell death.TIMP-1 Protein, Mouse (HEK293) is the recombinant mouse-derived TIMP-1 protein, expressed by HEK293 , with tag free.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
TIMP-1 is a metalloproteinase inhibitor that irreversibly inactivates collagenase and other metalloproteinases by binding to their catalytic zinc cofactor.It regulates MMP1, MMP2, MMP3, MMP7, MMP8, MMP9, MMP10, MMP11, MMP12, MMP13 and MMP16 and affects cellular processes such as differentiation, migration and cell death.TIMP-1 Protein, Mouse (HEK293) is the recombinant mouse-derived TIMP-1 protein, expressed by HEK293 , with tag free.
TIMP-1, a metalloproteinase inhibitor, exerts its regulatory function by forming one-to-one complexes with target metalloproteinases, such as collagenases, leading to the irreversible inactivation of these enzymes by binding to their catalytic zinc cofactor. This inhibitory action encompasses a spectrum of metalloproteinases, including MMP1, MMP2, MMP3, MMP7, MMP8, MMP9, MMP10, MMP11, MMP12, MMP13, and MMP16, with no observed effect on MMP14. Beyond its role as an enzyme inhibitor, TIMP-1 serves as a growth factor, influencing diverse cellular processes like differentiation, migration, and cell death. It activates signaling cascades through interactions with CD63 and ITGB1, implicating its involvement in integrin signaling. TIMP-1 also engages in protein-protein interactions with MMP1, MMP3, MMP10, and MMP13, demonstrating its regulatory influence on these metalloproteinases. Furthermore, it forms a complex with CD63 and ITGB1, indicating its participation in intricate cellular signaling networks.
Measured by its ability to inhibit human MMP-2 cleavage of a fluorogenic peptide substrate Mca-PLGL-Dpa-AR-NH2. The IC50 value is 0.131 nM, as measured under the described conditions.
Publications (1)
-
Journal Impact Factor
-
Most Recent
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag Tag Free
-
Accession
P12032 (C25-R205)
-
Molecular Construction
-
N-term
-
TIMP-1 (C25-R205)
Accession # P12032 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
TIMP1; Collagenase Inhibitor; Prev. CLGI; EPA; Prev. TIMP; Tissue Inhibitor Of Metalloproteinase 1 (Erythroid Potentiating Activity, Collagenase Inhibitor); Tissue Inhibitor Of Metalloproteinases 1; Epididymis Secretory Sperm Binding Protein; Metalloprote
-
AA Sequence
CSCAPPHPQTAFCNSDLVIRAKFMGSPEINETTLYQRYKIKMTKMLKGFKAVGNAADIRYAYTPVMESLCGYAHKSQNRSEEFLITGRLRNGNLHISACSFLVPWRTLSPAQQRAFSKTYSAGCGVCTVFPCLSIPCKLESDTHCLWTDQVLVGSEDYQSRHFACLPRNPGLCTWRSLGAR
-
Predicted Molecular Mass
20.2 kDa
-
Molecular Weight
Approximately 26 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of 20 mM Tris, 150 mM NaCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
