Copy Link Print Information

TL1A/TNFSF15 Protein, Mouse (HEK293, His)

Customer Review

Based on 1 Customer Validation

The TL1A/TNFSF15 protein is a receptor for TNFRSF25 and TNFRSF6B and is critical for activation of NF-kappa-B signaling. It promotes apoptotic caspase activation and exhibits anti-angiogenic properties, inhibiting vascular endothelial growth and angiogenesis in vitro. TL1A/TNFSF15, Mouse (HEK293, His) is the recombinant mouse-derived TL1A/TNFSF15 protein, expressed by HEK293, with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • TL1A/TNFSF15 Protein, Mouse (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The TL1A/TNFSF15 protein is a receptor for TNFRSF25 and TNFRSF6B and is critical for activation of NF-kappa-B signaling. It promotes apoptotic caspase activation and exhibits anti-angiogenic properties, inhibiting vascular endothelial growth and angiogenesis in vitro. TL1A/TNFSF15, Mouse (HEK293, His) is the recombinant mouse-derived TL1A/TNFSF15 protein, expressed by HEK293, with C-His labeled tag.

Background

The TL1A/TNFSF15 protein serves as the receptor for TNFRSF25 and TNFRSF6B, playing a crucial role in mediating the activation of NF-kappa-B signaling. Beyond its involvement in apoptosis by promoting the activation of caspases, TL1A/TNFSF15 exhibits anti-angiogenic properties, inhibiting vascular endothelial growth and angiogenesis in vitro. Furthermore, the protein contributes to splenocyte alloactivation, underscoring its significance in immune responses. TL1A/TNFSF15 functions as a homotrimer, reflecting its structural arrangement in these cellular processes.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human DcR3, Fc Tag at 5 μg/mL (100 μL/well) can bind Mouse TL1A , His Tag with the EC50 of 0.5-50 ng/mL.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag N-His
  • Accession

    Q5UBV8 (A61-L252)

  • Gene ID
    326623
  • Molecular Construction
    • N-term
    • His
    • TL1A (A61-L252)
      Accession # Q5UBV8
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    TNFSF15; TL1A; TNF Superfamily Member 15; Vascular Endothelial Growth Inhibitor-192A; Vascular Endothelial Cell Growth Inhibitor; Vascular Endothelial Growth Inhibitor; TNF Ligand-Related Molecule 1; TNF Superfamily Ligand TL1A; VEGI; MGC129934; TL1; MGC1

  • AA Sequence

    AGQLRVPGKDCMLRAITEERSEPSPQQVYSPPRGKPRAHLTIKKQTPAPHLKNQLSALHWEHDLGMAFTKNGMKYINKSLVIPESGDYFIYSQITFRGTTSVCGDISRGRRPNKPDSITVVITKVADSYPEPARLLTGSKSVCEISNNWFQSLYLGAMFSLEEGDRLMVNVSDISLVDYTKEDKTFFGAFLL

  • Predicted Molecular Mass

    23.4 kDa

  • Molecular Weight

    Approximately 27-29 kDa & 30-33 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from 0.22 μm filtered solution of PBS, 0.2 M Arginine, pH7.4 with 10% trehalose as protectant.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • TL1A/TNFSF15 Protein, Mouse (HEK293, His) Product Image
    1/16
  • TL1A/TNFSF15 Protein, Mouse (HEK293, His) Product Image