TL1A/TNFSF15 Protein, Human (161a.a, HEK293, His)

TL1A/TNFSF15 Protein, the receptor for TNFRSF25 and TNFRSF6B, activates NF-kappa-B and promotes caspase activation, leading to apoptosis. It also inhibits vascular endothelial growth and angiogenesis in vitro. Operating as a homotrimer, it plays a crucial role in diverse cellular processes, including immune response and apoptosis regulation. TL1A/TNFSF15 Trimer Protein, Human (HEK293, His) is the recombinant human-derived TL1A/TNFSF15 Trimer protein, expressed by HEK293 , with N-His labeled tag.

TL1A/TNFSF15 Protein acts as the receptor for TNFRSF25 and TNFRSF6B, facilitating the activation of NF-kappa-B and promoting the activation of caspases, leading to apoptosis. Additionally, it exhibits inhibitory effects on vascular endothelial growth and angiogenesis in vitro. The protein functions as a homotrimer, underscoring its role in diverse cellular processes, including immune response and apoptosis regulation.

Measured by its ability to induce apoptosis of TF-1 human erythroleukemic cells. The ED₅₀ for this effect is 3.851 ng/mL, corresponding to a specific activity is 2.596×10⁵ units/mg.

• 
  Measured by its ability to induce apoptosis of TF-1 human erythroleukemic cells. The ED₅₀ for this effect is 3.851 ng/mL, corresponding to a specific activity is 2.596×10⁵ units/mg.
• 
  Loaded TL1A/TNFSF15 Protein, Human (161a.a, HEK293, His) on AHC2 biosensor, can bind Duvakitug (HY-P990006) with an affinity constant of 4.777E-10 M as determined in BLI assay.

Human

HEK293

N-6*His

O95150-1 (D91-L251)

9966

Partial

DGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL

Approximately 20-26 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.