Copy Link Print Information

TMEFF2/Tomoregulin-2 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

TMEFF2/Tomoregulin-2 protein serves as a potential survival factor for hippocampal and midbrain neurons, supporting neuronal cell viability.In addition, its shed form may upregulate cancer cell proliferation by promoting ERK1/2 phosphorylation.TMEFF2/Tomoregulin-2 Protein, Human (HEK293, His) is the recombinant human-derived TMEFF2/Tomoregulin-2 protein, expressed by HEK293 , with C-10*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • TMEFF2/Tomoregulin-2 Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

TMEFF2/Tomoregulin-2 protein serves as a potential survival factor for hippocampal and midbrain neurons, supporting neuronal cell viability.In addition, its shed form may upregulate cancer cell proliferation by promoting ERK1/2 phosphorylation.TMEFF2/Tomoregulin-2 Protein, Human (HEK293, His) is the recombinant human-derived TMEFF2/Tomoregulin-2 protein, expressed by HEK293 , with C-10*His labeled tag.

Background

TMEFF2/Tomoregulin-2 Protein emerges as a potential survival factor for hippocampal and mesencephalic neurons, indicating its role in supporting the viability of neural cells. In addition to its neuroprotective function, the shedded form of TMEFF2/Tomoregulin-2 is implicated in up-regulating cancer cell proliferation, potentially by facilitating ERK1/2 phosphorylation. This dual role suggests a complex involvement in both neuronal survival and cancer cell proliferation, highlighting the versatility of TMEFF2 in diverse cellular contexts. Further exploration of the mechanisms underlying TMEFF2's impact on neuronal and cancer cell functions could provide valuable insights into its specific roles and potential therapeutic implications in neural and cancer biology.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human TMEFF2 at 2 μg/mL can bind Anti-TMEFF2 recombinant antibody, the EC50 is ≤7 ng/mL.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-10*His
  • Accession

    Q9UIK5 (F41-V320)

  • Gene ID
    23671  [NCBI]
  • Molecular Construction
    • N-term
    • TMEFF2 (F41-V320)
      Accession # Q9UIK5
    • 10*His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    TMEFF2; Cancer/Testis Antigen Family 120, Member 2; Transmembrane Protein With EGF Like And Two Follistatin Like Domains 2; Hyperplastic Polyposis Protein 1; TENB2; Transmembrane Protein TENB2; HPP1; Tomoregulin-2; TPEF; TR-2; CT120.2; Transmembrane Prote

  • AA Sequence

    FPTSLSDCQTPTGWNCSGYDDRENDLFLCDTNTCKFDGECLRIGDTVTCVCQFKCNNDYVPVCGSNGESYQNECYLRQAACKQQSEILVVSEGSCATDAGSGSGDGVHEGSGETSQKETSTCDICQFGAECDEDAEDVWCVCNIDCSQTNFNPLCASDGKSYDNACQIKEASCQKQEKIEVMSLGRCQDNTTTTTKSEDGHYARTDYAENANKLEESAREHHIPCPEHYNGFCMHGKCEHSINMQEPSCRCDAGYTGQHCEKKDYSVLYVVPGPVRFQYV

  • Predicted Molecular Mass

    32.3 kDa

  • Molecular Weight

    Approximately 47 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • TMEFF2/Tomoregulin-2 Protein, Human (HEK293, His) Product Image
    1/16
  • TMEFF2/Tomoregulin-2 Protein, Human (HEK293, His) Product Image