TMEM106B Protein, Mouse (HEK293, Fc)
Based on 1 Customer Validation
The TMEM106B protein is a key player in neurons involved in trafficking to late endosomes/lysosomes and potentially affects dendritic morphogenesis and maintenance by regulating lysosomal trafficking. It may act as a molecular brake on retrograde transport by interacting with MAP6. TMEM106B Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived TMEM106B protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The TMEM106B protein is a key player in neurons involved in trafficking to late endosomes/lysosomes and potentially affects dendritic morphogenesis and maintenance by regulating lysosomal trafficking. It may act as a molecular brake on retrograde transport by interacting with MAP6. TMEM106B Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived TMEM106B protein, expressed by HEK293 , with C-hFc labeled tag.
Background
In neurons, the TMEM106B protein assumes a multifaceted role, participating in the transport of late endosomes/lysosomes and potentially influencing dendrite morphogenesis and maintenance by regulating lysosomal trafficking. It may act as a molecular brake for retrograde transport of late endosomes/lysosomes, possibly through its interaction with MAP6. Specifically in motoneurons, TMEM106B is implicated in mediating the axonal transport of lysosomes and axonal sorting at the initial segment. The exact directionality of its impact on the transport of moving lysosomes in neurites and its significance in lysosomal sorting within axons or dendrites remain unclear. Additionally, TMEM106B may play a role in the regulation of lysosomal size and responsiveness to stress in neurons, and it is essential for proper lysosomal acidification. The protein can form homomers and interacts with MAP6, vacuolar-type ATPase subunit ATP6AP1, AP2M1, CLTC, and TMEM106C, further highlighting its diverse molecular interactions in cellular processes.
Verified Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized CoV-2 S Protein RBD (HY-P73664) at 2 μg/mL (100μL/well) can bind TMEM106B, Mouse. The ED50 for this effect is 0.8002 μg/mL.
MCE Validation Data
-
Bioactivity - ELISA
Bioactivity - ELISA
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-hFc
-
Accession
Q80X71 (P119-Q275)
-
Molecular Construction
-
N-term
-
TMEM106B (P119-Q275)
Accession # Q80X71 -
hFc
-
C-term
-
-
Protein Length
Lumenal Domain
-
Synonyms
TMEM106B; FLJ11273; Transmembrane Protein 106B; HLD16; MGC33727
-
AA Sequence
PRSIEVKYIGVKSAYVSYDAEKRTIYLNITNTLNITNNNYYSVEVENITAQVQFSKTVIGKARLNNITNIGPLDMKQIDYTVPTVIAEEMSYMYDFCTLLSIKVHNIVLMMQVTVTTAYFGHSEQISQERYQYVDCGRNTTYQLAQSEYLNVLQPQQ
-
Predicted Molecular Mass
44.8 kDa
-
Molecular Weight
Approximately 65-68 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
