1. Recombinant Proteins
  2. Others
  3. TMEM106B Protein, Mouse (HEK293, Fc)

The TMEM106B protein is a key player in neurons involved in trafficking to late endosomes/lysosomes and potentially affects dendritic morphogenesis and maintenance by regulating lysosomal trafficking. It may act as a molecular brake on retrograde transport by interacting with MAP6. TMEM106B Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived TMEM106B protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The TMEM106B protein is a key player in neurons involved in trafficking to late endosomes/lysosomes and potentially affects dendritic morphogenesis and maintenance by regulating lysosomal trafficking. It may act as a molecular brake on retrograde transport by interacting with MAP6. TMEM106B Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived TMEM106B protein, expressed by HEK293 , with C-hFc labeled tag.

Background

In neurons, the TMEM106B protein assumes a multifaceted role, participating in the transport of late endosomes/lysosomes and potentially influencing dendrite morphogenesis and maintenance by regulating lysosomal trafficking. It may act as a molecular brake for retrograde transport of late endosomes/lysosomes, possibly through its interaction with MAP6. Specifically in motoneurons, TMEM106B is implicated in mediating the axonal transport of lysosomes and axonal sorting at the initial segment. The exact directionality of its impact on the transport of moving lysosomes in neurites and its significance in lysosomal sorting within axons or dendrites remain unclear. Additionally, TMEM106B may play a role in the regulation of lysosomal size and responsiveness to stress in neurons, and it is essential for proper lysosomal acidification. The protein can form homomers and interacts with MAP6, vacuolar-type ATPase subunit ATP6AP1, AP2M1, CLTC, and TMEM106C, further highlighting its diverse molecular interactions in cellular processes.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized CoV-2 S Protein RBD (HY-P73664) at 2 μg/mL (100μL/well) can bind TMEM106B, Mouse. The ED50 for this effect is 0.8002 μg/mL.

  • Measured by its binding ability in a functional ELISA. Immobilized CoV-2 S Protein RBD (HY-P73664) at 2 μg/mL (100μL/well) can bind TMEM106B, Mouse. The ED50 for this effect is 0.8002 μg/mL.
Species

Mouse

Source

HEK293

Tag

C-hFc

Accession

Q80X71 (P119-Q275)

Gene ID
Molecular Construction
N-term
TMEM106B (P119-Q275)
Accession # Q80X71
hFc
C-term
Protein Length

Lumenal Domain

Synonyms
Transmembrane protein 106B; Tmem106b
AA Sequence

PRSIEVKYIGVKSAYVSYDAEKRTIYLNITNTLNITNNNYYSVEVENITAQVQFSKTVIGKARLNNITNIGPLDMKQIDYTVPTVIAEEMSYMYDFCTLLSIKVHNIVLMMQVTVTTAYFGHSEQISQERYQYVDCGRNTTYQLAQSEYLNVLQPQQ

Predicted Molecular Mass
44.8 kDa
Molecular Weight

Approximately 65-68 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by Bis-Tris PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

TMEM106B Protein, Mouse (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

TMEM106B Protein, Mouse (HEK293, Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TMEM106B Protein, Mouse (HEK293, Fc)
Cat. No.:
HY-P77854
Quantity:
MCE Japan Authorized Agent: