TMIGD1 Protein, Human (HEK293, Fc)
TMIGD1 is a potential regulator that affects multiple cellular processes, including adhesion, migration, proliferation, and morphology. Its protective effect against oxidative damage in renal epithelial cells promotes cell survival. TMIGD1 Protein, Human (HEK293, Fc) is the recombinant human-derived TMIGD1 protein, expressed by HEK293 , with C-mFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
TMIGD1 is a potential regulator that affects multiple cellular processes, including adhesion, migration, proliferation, and morphology. Its protective effect against oxidative damage in renal epithelial cells promotes cell survival. TMIGD1 Protein, Human (HEK293, Fc) is the recombinant human-derived TMIGD1 protein, expressed by HEK293 , with C-mFc labeled tag.
Background
The TMIGD1 protein emerges as a potential regulator influencing diverse cellular processes, including cell-cell adhesion, migration, proliferation, and morphology. Additionally, TMIGD1 exhibits a protective role in renal epithelial cells by safeguarding them against oxidative cell injury, thereby promoting cell survival. The formation of homodimers by TMIGD1 indicates its ability to interact with itself, possibly playing a role in the modulation of its functional activities. The multifaceted nature of TMIGD1 in cellular regulation underscores its potential significance in maintaining cellular homeostasis and responding to environmental challenges. Further exploration is essential to uncover the specific molecular mechanisms through which TMIGD1 exerts its regulatory effects on cell behavior and survival.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-mFc
-
Accession
Q6UXZ0-1 (V30-P220)
-
Molecular Construction
-
N-term
-
TMIGD1 (V30-P220)
Accession # Q6UXZ0-1 -
mFc
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
TMIGD1; UNQ9372; Prev. TMIGD; AWKS9372; Transmembrane And Immunoglobulin Domain Containing 1; Transmembrane And Immunoglobulin Domain-Containing Protein 1
-
AA Sequence
VLTVNGKTENYILDTTPGSQASLICAVQNHTREEELLWYREEGRVDLKSGNKINSSSVCVSSISENDNGISFTCRLGRDQSVSVSVVLNVTFPPLLSGNDFQTVEEGSNVKLVCNVKANPQAQMMWYKNSSLLDLEKSRHQIQQTSESFQLSITKVEKPDNGTYSCIAKSSLKTESLDFHLIVKDKTVGVP
-
Predicted Molecular Mass
47.5 kDa
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
