TNF-alpha/TNFSF2 Protein, Bovine (His)
TNF-α/TNFSF2 protein is secreted by macrophages, binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR, induces tumor cell death and acts as a pyrogen. It is associated with cachexia, stimulates cell proliferation and differentiation, and induces insulin resistance in adipocytes. TNF-alpha/TNFSF2 Protein, Bovine (His) is the recombinant bovine-derived TNF-alpha/TNFSF2 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Bovine
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
TNF-α/TNFSF2 protein is secreted by macrophages, binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR, induces tumor cell death and acts as a pyrogen. It is associated with cachexia, stimulates cell proliferation and differentiation, and induces insulin resistance in adipocytes. TNF-alpha/TNFSF2 Protein, Bovine (His) is the recombinant bovine-derived TNF-alpha/TNFSF2 protein, expressed by E. coli , with N-6*His labeled tag.
Background
TNF-alpha/TNFSF2 protein, a cytokine, binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. Primarily secreted by macrophages, it demonstrates the capacity to induce cell death in specific tumor cell lines and acts as a potent pyrogen, causing fever either through direct action or by stimulating interleukin-1 secretion. Additionally, TNF-alpha is implicated in the induction of cachexia, and under certain conditions, it can promote cell proliferation and induce cell differentiation. Its impact extends to inducing insulin resistance in adipocytes by inhibiting insulin-induced IRS1 tyrosine phosphorylation and glucose uptake, leading to GKAP42 protein degradation and TNF-induced insulin resistance. Playing a role in angiogenesis, TNF-alpha collaboratively induces VEGF production with IL1B and IL6. Furthermore, it facilitates osteoclastogenesis, contributing to bone resorption. Notably, the TNF intracellular domain (ICD) form elicits IL12 production in dendritic cells, showcasing its diverse involvement across various physiological processes.
Technical Parameters
-
Species Bovine
-
Source E. coli
-
Tag N-6*His
-
Accession
Q06599-1 (L78-L234)
-
Molecular Construction
-
N-term
-
6*His
-
TGF-α (L78-L234)
Accession # Q06599-1 -
C-term
-
-
Protein Length
Full Length of Tumor necrosis factor, soluble form Chain
-
Synonyms
TNF; Tumor Necrosis Factor (TNF Superfamily, Member 2); Prev. TNFA; Tumor Necrosis Factor-Alpha; TNF-Alpha; Tumor Necrotic Factor Alpha; TNFSF2; TNF Superfamily, Member 2; Tumor Necrosis Factor Ligand Superfamily Member 2; TNF, Macrophage-Derived; TNF-A;
-
AA Sequence
LRSSSQASSNKPVAHVVADINSPGQLRWWDSYANALMANGVKLEDNQLVVPADGLYLIYSQVLFRGQGCPSTPLFLTHTISRIAVSYQTKVNILSAIKSPCHRETPEWAEAKPWYEPIYQGGVFQLEKGDRLSAEINLPDYLDYAESGQVYFGIIAL
-
Predicted Molecular Mass
21.4 kDa
-
Molecular Weight
Approximately 18-20 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
