TNF-alpha/TNFSF2 Protein, Sheep (His)
Based on 1 Customer Validation
TNF-α/TNFSF2 protein is a macrophage-secreted cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR, inducing tumor cell death and acting as a pyrogen. It is associated with cachexia, stimulates cell proliferation, promotes differentiation, and induces insulin resistance in adipocytes, leading to TNF-induced insulin resistance. TNF-alpha/TNFSF2 Protein, Sheep (His) is the recombinant sheep-derived TNF-alpha/TNFSF2 protein, expressed by E. coli , with C-6*His labeled tag.
- Species: Sheep
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
TNF-α/TNFSF2 protein is a macrophage-secreted cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR, inducing tumor cell death and acting as a pyrogen. It is associated with cachexia, stimulates cell proliferation, promotes differentiation, and induces insulin resistance in adipocytes, leading to TNF-induced insulin resistance. TNF-alpha/TNFSF2 Protein, Sheep (His) is the recombinant sheep-derived TNF-alpha/TNFSF2 protein, expressed by E. coli , with C-6*His labeled tag.
Background
TNF-alpha/TNFSF2 Protein, a cytokine, binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is primarily secreted by macrophages and has multiple biological activities. It can induce cell death in certain tumor cell lines and acts as a potent pyrogen, causing fever either through direct action or by stimulating interleukin-1 secretion. TNF-alpha/TNFSF2 Protein is also implicated in the induction of cachexia. Under specific conditions, it can stimulate cell proliferation and promote cell differentiation. Additionally, it induces insulin resistance in adipocytes by inhibiting insulin-induced IRS1 tyrosine phosphorylation and glucose uptake, while also leading to GKAP42 protein degradation, which contributes to TNF-induced insulin resistance. TNF-alpha/TNFSF2 Protein plays a role in angiogenesis by synergistically inducing VEGF production with IL1B and IL6. Moreover, it facilitates osteoclastogenesis and, consequently, mediates bone resorption. Lastly, the TNF intracellular domain (ICD) form of TNF-alpha/TNFSF2 Protein stimulates IL12 production in dendritic cells.
Technical Parameters
-
Species Sheep
-
Source E. coli
-
Tag C-6*His
-
Accession
P23383 (L78-L234)
-
Gene ID443540
-
Molecular Construction
-
N-term
-
TGF-α (L78-L234)
Accession # P23383 -
6*His
-
C-term
-
-
Protein Length
Full Length of Tumor necrosis factor, soluble form Chain
-
Synonyms
TNF; Tumor Necrosis Factor (TNF Superfamily, Member 2); Prev. TNFA; Tumor Necrosis Factor-Alpha; TNF-Alpha; Tumor Necrotic Factor Alpha; TNFSF2; TNF Superfamily, Member 2; Tumor Necrosis Factor Ligand Superfamily Member 2; TNF, Macrophage-Derived; TNF-A; TNF, Monocyte-Derived; DIF; APC1 Protein; Cachectin; IMD127; TNLG1F; Tumor Necrosis Factor; Tumor Necrosis Factor Ligand 1F
-
AA Sequence
LRSSSQASNNKPVAHVVANISAPGQLRWGDSYANALMANGVELKDNQLVVPTDGLYLIYSQVLFRGHGCPSTPLFLTHTISRIAVSYQTKVNILSAIKSPCHRETLEGAEAKPWYEPIYQGGVFQLEKGDRLSAEINLPEYLDYAESGQVYFGIIAL
-
Molecular Weight
Approximately 26 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
