TRAT1 Protein, Human (His)

TRAT1 protein stabilizes the T-cell antigen receptor (TCR)/CD3 complex on T-cell surfaces. As a homodimer linked by disulfide bonds, TRAT1 interacts with CD3Z, enhancing the structural integrity and function of the TCR/CD3 complex. Phosphorylated TRAT1 also engages with PIK3R1, indicating its role in signaling pathways related to T-cell activation and response. TRAT1 Protein, Human (His) is the recombinant human-derived TRAT1 protein, expressed by E. coli , with C-6*His labeled tag.

T Cell Receptor-Associated Transmembrane Adaptor 1 (TRAT1) protein functions as a stabilizer for the T-cell antigen receptor (TCR)/CD3 complex on the surface of T-cells. Existing as a homodimer through disulfide linkages, TRAT1 engages in interactions with CD3Z, contributing to the structural integrity and proper functioning of the TCR/CD3 complex. Upon phosphorylation, TRAT1 further interacts with PIK3R1, suggesting its involvement in signaling pathways associated with T-cell activation and response.

Human

E. coli

C-6*His

Q6PIZ9 (N29-N186)

50852  [NCBI]

Cytoplasmic Domain

NISHYVEKQRQDKMYSYSSDHTRVDEYYIEDTPIYGNLDDMISEPMDENCYEQMKARPEKSVNKMQEATPSAQATNETQMCYASLDHSVKGKRRKPRKQNTHFSDKDGDEQLHAIDASVSKTTLVDSFSPESQAVEENIHDDPIRLFGLIRAKREPIN

Approximately 30 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.