TRAT1 Protein, Human (His)

TRAT1 protein stabilizes the T-cell antigen receptor (TCR)/CD3 complex on T-cell surfaces. As a homodimer linked by disulfide bonds, TRAT1 interacts with CD3Z, enhancing the structural integrity and function of the TCR/CD3 complex. Phosphorylated TRAT1 also engages with PIK3R1, indicating its role in signaling pathways related to T-cell activation and response. TRAT1 Protein, Human (His) is the recombinant human-derived TRAT1 protein, expressed by E. coli , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

TRAT1 protein stabilizes the T-cell antigen receptor (TCR)/CD3 complex on T-cell surfaces. As a homodimer linked by disulfide bonds, TRAT1 interacts with CD3Z, enhancing the structural integrity and function of the TCR/CD3 complex. Phosphorylated TRAT1 also engages with PIK3R1, indicating its role in signaling pathways related to T-cell activation and response. TRAT1 Protein, Human (His) is the recombinant human-derived TRAT1 protein, expressed by E. coli , with C-6*His labeled tag.

Background

T Cell Receptor-Associated Transmembrane Adaptor 1 (TRAT1) protein functions as a stabilizer for the T-cell antigen receptor (TCR)/CD3 complex on the surface of T-cells. Existing as a homodimer through disulfide linkages, TRAT1 engages in interactions with CD3Z, contributing to the structural integrity and proper functioning of the TCR/CD3 complex. Upon phosphorylation, TRAT1 further interacts with PIK3R1, suggesting its involvement in signaling pathways associated with T-cell activation and response.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • TRAT1 (N29-N186)
      Accession # Q6PIZ9
    • 6*His
    • C-term
  • Protein Length

    Cytoplasmic Domain

  • Synonyms

    TRAT1; T-Cell Receptor-Associated Transmembrane Adapter 1; Prev. TCRIM; T Cell Receptor Interacting Molecule; TRIM; T-Cell Receptor-Interacting Molecule; HSPC062; T Cell Receptor Associated Transmembrane Adaptor 1; Pp29/30

  • AA Sequence

    NISHYVEKQRQDKMYSYSSDHTRVDEYYIEDTPIYGNLDDMISEPMDENCYEQMKARPEKSVNKMQEATPSAQATNETQMCYASLDHSVKGKRRKPRKQNTHFSDKDGDEQLHAIDASVSKTTLVDSFSPESQAVEENIHDDPIRLFGLIRAKREPIN

  • Predicted Molecular Mass

    19.4 kDa

  • Molecular Weight

    Approximately 30 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00