TRAT1 Protein, Human (His)
TRAT1 protein stabilizes the T-cell antigen receptor (TCR)/CD3 complex on T-cell surfaces. As a homodimer linked by disulfide bonds, TRAT1 interacts with CD3Z, enhancing the structural integrity and function of the TCR/CD3 complex. Phosphorylated TRAT1 also engages with PIK3R1, indicating its role in signaling pathways related to T-cell activation and response. TRAT1 Protein, Human (His) is the recombinant human-derived TRAT1 protein, expressed by E. coli , with C-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
TRAT1 protein stabilizes the T-cell antigen receptor (TCR)/CD3 complex on T-cell surfaces. As a homodimer linked by disulfide bonds, TRAT1 interacts with CD3Z, enhancing the structural integrity and function of the TCR/CD3 complex. Phosphorylated TRAT1 also engages with PIK3R1, indicating its role in signaling pathways related to T-cell activation and response. TRAT1 Protein, Human (His) is the recombinant human-derived TRAT1 protein, expressed by E. coli , with C-6*His labeled tag.
Background
T Cell Receptor-Associated Transmembrane Adaptor 1 (TRAT1) protein functions as a stabilizer for the T-cell antigen receptor (TCR)/CD3 complex on the surface of T-cells. Existing as a homodimer through disulfide linkages, TRAT1 engages in interactions with CD3Z, contributing to the structural integrity and proper functioning of the TCR/CD3 complex. Upon phosphorylation, TRAT1 further interacts with PIK3R1, suggesting its involvement in signaling pathways associated with T-cell activation and response.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-6*His
-
Accession
Q6PIZ9 (N29-N186)
-
Molecular Construction
-
N-term
-
TRAT1 (N29-N186)
Accession # Q6PIZ9 -
6*His
-
C-term
-
-
Protein Length
Cytoplasmic Domain
-
Synonyms
TRAT1; T-Cell Receptor-Associated Transmembrane Adapter 1; Prev. TCRIM; T Cell Receptor Interacting Molecule; TRIM; T-Cell Receptor-Interacting Molecule; HSPC062; T Cell Receptor Associated Transmembrane Adaptor 1; Pp29/30
-
AA Sequence
NISHYVEKQRQDKMYSYSSDHTRVDEYYIEDTPIYGNLDDMISEPMDENCYEQMKARPEKSVNKMQEATPSAQATNETQMCYASLDHSVKGKRRKPRKQNTHFSDKDGDEQLHAIDASVSKTTLVDSFSPESQAVEENIHDDPIRLFGLIRAKREPIN
-
Predicted Molecular Mass
19.4 kDa
-
Molecular Weight
Approximately 30 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)