TRIP10/CIP4 Protein, Human (sf9, His)
TRIP10/CIP4 proteins coordinate cellular dynamics and are critical for insulin-induced GLUT4 translocation and membrane tubulation during endocytosis. Good at lipid binding, especially with phosphatidylinositol 4,5-bisphosphate and phosphatidylserine, promoting membrane invagination. TRIP10/CIP4 Protein, Human (sf9, His) is the recombinant human-derived TRIP10/CIP4 protein, expressed by Sf9 insect cells , with C-His labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
TRIP10/CIP4 proteins coordinate cellular dynamics and are critical for insulin-induced GLUT4 translocation and membrane tubulation during endocytosis. Good at lipid binding, especially with phosphatidylinositol 4,5-bisphosphate and phosphatidylserine, promoting membrane invagination. TRIP10/CIP4 Protein, Human (sf9, His) is the recombinant human-derived TRIP10/CIP4 protein, expressed by Sf9 insect cells , with C-His labeled tag.
Background
TRIP10/CIP4 Protein emerges as a pivotal orchestrator in cellular dynamics, playing a crucial role in diverse processes ranging from insulin-induced GLUT4 translocation to the plasma membrane to the coordination of membrane tubulation during endocytosis. This multifaceted protein is adept at binding lipids, including phosphatidylinositol 4,5-bisphosphate and phosphatidylserine, thereby promoting membrane invagination and the formation of tubules. TRIP10/CIP4 also showcases its versatility by participating in CDC42-induced actin polymerization, recruiting the essential regulator WASL/N-WASP, and activating the Arp2/3 complex. The resultant actin polymerization facilitates the fission of membrane tubules, contributing to the formation of endocytic vesicles. Beyond endocytosis, TRIP10/CIP4 is a key player in podosome formation, specialized actin-rich adhesion structures found in monocyte-derived cells. Additionally, it may play a role in the lysosomal retention of FASLG/FASL. The intricate web of protein-protein interactions involves specific binding with GTP-bound RHOQ, CDC42, DNM2, PDE6G, and various other partners, underscoring its central role in cellular processes. The ability of TRIP10/CIP4 to homodimerize and form filamentous structures adds another layer to its dynamic functionality, making it a pivotal player in the intricate tapestry of cellular regulation.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag C-His
-
Accession
NP_004231.1 (M1-N545)
-
Molecular Construction
-
N-term
-
TRIP10 (M1-N545)
Accession # Q15642 -
His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
Cdc42-interacting protein 4; Protein Felic; Salt tolerant protein; hSTP; Thyroid receptor-interacting protein 10; TR-interacting protein 10; TRIP-10; TRIP10; CIP4; STOT; STP; CIP4; Thyroid Hormone Receptor Interactor 10; Cdc42-Interacting Protein
-
AA Sequence
MDWGTELWDQFEVLERHTQWGLDLLDRYVKFVKERTEVEQAYAKQLRSLVKKYLPKRPAKDDPESKFSQQQSFVQILQEVNDFAGQRELVAENLSVRVCLELTKYSQEMKQERKMHFQEGRRAQQQLENGFKQLENSKRK FERDCREAEKAAQTAERLDQDINATKADVEKAKQQAHLRSHMAEESKNEYAAQLQRFNRDQAHFYFSQMP QIFDKLQDMDERRATRLGAGYGLLSEAELEVVPIIAKCLEGMKVAANAVDPKNDSHVLIELHKSGFARPG DVEFEDFSQPMNRAPSDSSLGTPSDGRPELRGPGRSRTKRWPFGKKNKTVVTEDFSHLPPEQQRKRLQQQ LEERSRELQKEVDQREALKKMKDVYEKTPQMGDPASLEPQIAETLSNIERLKLEVQKYEAWLAEAESRVL SNRGDSLSRHARPPDPPASAPPDSSSNSASQDTKESSEEPPSEESQDTPIYTEFDEDFEEEPTSPIGHCV AIYHFEGSSEGTISMAEGEDLSLMEEDKGDGWTRVRRKEGGEGYVPTSYLRVTLN
-
Predicted Molecular Mass
64 kDa
-
Molecular Weight
Approximately 84 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)