TRIP10/CIP4 Protein, Human (sf9, His)

TRIP10/CIP4 proteins coordinate cellular dynamics and are critical for insulin-induced GLUT4 translocation and membrane tubulation during endocytosis. Good at lipid binding, especially with phosphatidylinositol 4,5-bisphosphate and phosphatidylserine, promoting membrane invagination. TRIP10/CIP4 Protein, Human (sf9, His) is the recombinant human-derived TRIP10/CIP4 protein, expressed by Sf9 insect cells , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

TRIP10/CIP4 proteins coordinate cellular dynamics and are critical for insulin-induced GLUT4 translocation and membrane tubulation during endocytosis. Good at lipid binding, especially with phosphatidylinositol 4,5-bisphosphate and phosphatidylserine, promoting membrane invagination. TRIP10/CIP4 Protein, Human (sf9, His) is the recombinant human-derived TRIP10/CIP4 protein, expressed by Sf9 insect cells , with C-His labeled tag.

Background

TRIP10/CIP4 Protein emerges as a pivotal orchestrator in cellular dynamics, playing a crucial role in diverse processes ranging from insulin-induced GLUT4 translocation to the plasma membrane to the coordination of membrane tubulation during endocytosis. This multifaceted protein is adept at binding lipids, including phosphatidylinositol 4,5-bisphosphate and phosphatidylserine, thereby promoting membrane invagination and the formation of tubules. TRIP10/CIP4 also showcases its versatility by participating in CDC42-induced actin polymerization, recruiting the essential regulator WASL/N-WASP, and activating the Arp2/3 complex. The resultant actin polymerization facilitates the fission of membrane tubules, contributing to the formation of endocytic vesicles. Beyond endocytosis, TRIP10/CIP4 is a key player in podosome formation, specialized actin-rich adhesion structures found in monocyte-derived cells. Additionally, it may play a role in the lysosomal retention of FASLG/FASL. The intricate web of protein-protein interactions involves specific binding with GTP-bound RHOQ, CDC42, DNM2, PDE6G, and various other partners, underscoring its central role in cellular processes. The ability of TRIP10/CIP4 to homodimerize and form filamentous structures adds another layer to its dynamic functionality, making it a pivotal player in the intricate tapestry of cellular regulation.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • TRIP10 (M1-N545)
      Accession # Q15642
    • His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    Cdc42-interacting protein 4; Protein Felic; Salt tolerant protein; hSTP; Thyroid receptor-interacting protein 10; TR-interacting protein 10; TRIP-10; TRIP10; CIP4; STOT; STP; CIP4; Thyroid Hormone Receptor Interactor 10; Cdc42-Interacting Protein

  • AA Sequence

    MDWGTELWDQFEVLERHTQWGLDLLDRYVKFVKERTEVEQAYAKQLRSLVKKYLPKRPAKDDPESKFSQQQSFVQILQEVNDFAGQRELVAENLSVRVCLELTKYSQEMKQERKMHFQEGRRAQQQLENGFKQLENSKRK FERDCREAEKAAQTAERLDQDINATKADVEKAKQQAHLRSHMAEESKNEYAAQLQRFNRDQAHFYFSQMP QIFDKLQDMDERRATRLGAGYGLLSEAELEVVPIIAKCLEGMKVAANAVDPKNDSHVLIELHKSGFARPG DVEFEDFSQPMNRAPSDSSLGTPSDGRPELRGPGRSRTKRWPFGKKNKTVVTEDFSHLPPEQQRKRLQQQ LEERSRELQKEVDQREALKKMKDVYEKTPQMGDPASLEPQIAETLSNIERLKLEVQKYEAWLAEAESRVL SNRGDSLSRHARPPDPPASAPPDSSSNSASQDTKESSEEPPSEESQDTPIYTEFDEDFEEEPTSPIGHCV AIYHFEGSSEGTISMAEGEDLSLMEEDKGDGWTRVRRKEGGEGYVPTSYLRVTLN

  • Predicted Molecular Mass

    64 kDa

  • Molecular Weight

    Approximately 84 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 85%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00