TROP-2 Protein, Human (Biotinylated, HEK293, His-Avi)
Based on 1 Customer Validation
The TROP-2 protein emerged as a potential growth factor receptor, implying involvement in cellular processes related to growth and signaling. As a putative receptor, TROP-2 may play a crucial role in transducing signals that regulate cell growth and proliferation. TROP-2 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived TROP-2 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The TROP-2 protein emerged as a potential growth factor receptor, implying involvement in cellular processes related to growth and signaling. As a putative receptor, TROP-2 may play a crucial role in transducing signals that regulate cell growth and proliferation. TROP-2 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived TROP-2 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.
Background
The TROP-2 protein emerges as a potential growth factor receptor, suggesting its involvement in cellular processes related to growth and signaling. As a putative receptor, TROP-2 may play a crucial role in transducing signals that regulate cell growth, proliferation, and potentially other cellular functions. The specific ligands and downstream pathways associated with TROP-2-mediated growth factor signaling remain areas for further investigation. Unraveling the detailed molecular mechanisms and functional implications of TROP-2 in growth factor signaling will contribute to a comprehensive understanding of its role in cellular physiology and may open avenues for therapeutic interventions targeting this receptor.
Verified Bioactivity
1.Measured by its binding ability in a functional ELISA. When immobilized Anti-TROP-2 Antibody hFc at 0.5 μg/mL (100 μl/Well), can bind Biotinylated Human TROP-2 His Tag and the EC50 is 48.4 ng/mL.
2.Immobilized Biotinylated Human TROP-2, His-Avi Tag at 0.5 μg/ml (100μl/well) on the streptavidin precoated plate (5 μg/ml). Dose response curve for Anti-TROP-2 Antibody, hFc Tag with the EC50 of 2.5 ng/ml determined by ELISA.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-Avi;C-6*His
-
Accession
P09758 (H27-T274)
-
Molecular Construction
-
N-term
-
TROP-2 (H27-T274)
Accession # P09758 -
6*His-Avi
-
C-term
-
-
Protein Length
Extracellular Domain
-
Conjugation
Biotin
-
Conjugate Method
The single lysine residue in Avitag is biotinylated through an enzymatic reaction.
-
Synonyms
TACSTD2; Epithelial Glycoprotein-1; Prev. M1S1; Membrane Component, Chromosome 1, Surface Marker 1; GA733-1; Gastrointestinal Tumor-Associated Antigen GA7331; TROP2; Pancreatic Carcinoma Marker Protein GA7331; Tumor-Associated Calcium Signal Transducer 2;
-
AA Sequence
HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT
-
Predicted Molecular Mass
30.5 kDa
-
Molecular Weight
Approximately 46-55 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
