1. Recombinant Proteins
  2. CAR-T Related Proteins
  3. TROP-2
  4. TROP-2 Protein, Human (HEK293, His-hFc)

The TROP-2 protein emerged as a potential growth factor receptor, implying involvement in cellular processes related to growth and signaling. As a putative receptor, TROP-2 may play a crucial role in transducing signals that regulate cell growth and proliferation. TROP-2 Protein, Human (HEK293, His-hFc) is the recombinant human-derived TROP-2 protein, expressed by HEK293 , with C-hFc, C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The TROP-2 protein emerged as a potential growth factor receptor, implying involvement in cellular processes related to growth and signaling. As a putative receptor, TROP-2 may play a crucial role in transducing signals that regulate cell growth and proliferation. TROP-2 Protein, Human (HEK293, His-hFc) is the recombinant human-derived TROP-2 protein, expressed by HEK293 , with C-hFc, C-His labeled tag.

Background

The TROP-2 protein emerges as a potential growth factor receptor, suggesting its involvement in cellular processes related to growth and signaling. As a putative receptor, TROP-2 may play a crucial role in transducing signals that regulate cell growth, proliferation, and potentially other cellular functions. The specific ligands and downstream pathways associated with TROP-2-mediated growth factor signaling remain areas for further investigation. Unraveling the detailed molecular mechanisms and functional implications of TROP-2 in growth factor signaling will contribute to a comprehensive understanding of its role in cellular physiology and may open avenues for therapeutic interventions targeting this receptor.

Species

Human

Source

HEK293

Tag

C-hFc;C-His

Accession

P09758 (H27-T274)

Gene ID
Molecular Construction
N-term
TROP-2 (H27-T274)
Accession # P09758
hFc-His
C-term
Protein Length

Extracellular Domain

Synonyms
Tumor-associated calcium signal transducer 2; Cell surface glycoprotein Trop-2; TACSTD2; TROP2
AA Sequence

HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT

Predicted Molecular Mass
55.7 kDa
Molecular Weight

Approximately 65-75 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

TROP-2 Protein, Human (HEK293, His-hFc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

TROP-2 Protein, Human (HEK293, His-hFc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TROP-2 Protein, Human (HEK293, His-hFc)
Cat. No.:
HY-P74490
Quantity:
MCE Japan Authorized Agent: