TROP-2 Protein, Rhesus macaque (HEK293, His)
Based on 1 Customer Validation
Tumor associated calcium signal transducer 2 (TACSTD2) is a carcinoma-associated antigen which is a cell surface receptor that transduces calcium signals and may also function as a growth factor receptor. TACSTD2 is involved in negative regulation of branching involved in ureteric bud morphogenesis; negative regulation of cellular component organization; negative regulation of substrate adhesion-dependent cell spreading; positive regulation of stem cell differentiation; and regulation of epithelial cell proliferation. TROP-2 Protein, Rhesus macaque (HEK293, His) is the recombinant Rhesus Macaque-derived TROP-2 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Rhesus Macaque
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Tumor associated calcium signal transducer 2 (TACSTD2) is a carcinoma-associated antigen which is a cell surface receptor that transduces calcium signals and may also function as a growth factor receptor. TACSTD2 is involved in negative regulation of branching involved in ureteric bud morphogenesis; negative regulation of cellular component organization; negative regulation of substrate adhesion-dependent cell spreading; positive regulation of stem cell differentiation; and regulation of epithelial cell proliferation. TROP-2 Protein, Rhesus macaque (HEK293, His) is the recombinant Rhesus Macaque-derived TROP-2 protein, expressed by HEK293 , with C-6*His labeled tag.
Background
Tumor associated calcium signal transducer 2 (TACSTD2) is a carcinoma-associated antigen which is a cell surface receptor that transduces calcium signals. Mutations of TACSTD2 have been associated with gelatinous drop-like corneal dystrophy. TACSTD2 may also function as a growth factor receptor. TACSTD2 is involved in several processes, including negative regulation of branching involved in ureteric bud morphogenesis; negative regulation of cellular component organization; negative regulation of substrate adhesion-dependent cell spreading; positive regulation of stem cell differentiation; and regulation of epithelial cell proliferation. TACSTD2 is located in several cellular components, including basal plasma membrane; extracellular space; and lateral plasma membrane.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Rhesus Macaque
-
Source HEK293
-
Tag C-6*His
-
Accession
XP_001114599.1 (H27-R272)
-
Molecular Construction
-
N-term
-
TROP-2 (H27-R272)
Accession # XP_001114599.1 -
6*His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
TACSTD2; Epithelial Glycoprotein-1; Prev. M1S1; Membrane Component, Chromosome 1, Surface Marker 1; GA733-1; Gastrointestinal Tumor-Associated Antigen GA7331; TROP2; Pancreatic Carcinoma Marker Protein GA7331; Tumor-Associated Calcium Signal Transducer 2;
-
AA Sequence
HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGVAVDCSTLTSKCLLLKARMSAPKNARTLVRPNEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDVKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKR
-
Predicted Molecular Mass
28.7 kDa
-
Molecular Weight
Approximately 38-45 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
