TSPAN8 Protein, Mouse (HEK293, His)
TSPAN8 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TSPAN8 protein, expressed by HEK293, with N-His tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
TSPAN8 Protein, Mouse (HEK293, His) is the recombinant mouse-derived TSPAN8 protein, expressed by HEK293, with N-His tag.
Background
TSPAN8 plays an important role in promoting tumor metastasis by activating the EGFR/AKT pathway[1].
TSPAN8 alleviates high-glucose-induced autophagy and apoptosis in HK-2 cells by targeting mTORC2[2].
TSPAN8 forms protein complexes mediated by TSPAN8 through interactions with itself and various other cell signaling molecules. These protein complexes help to construct tetraspan-rich microdomains (TEMs), which effectively mediate intracellular signaling transduction. In addition, TSPAN8 plays a crucial role in regulating biological functions such as leukocyte migration, angiogenesis, and wound repair[3].
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag N-His
-
Accession
Q8R3G9-1 (G106-N203)
-
Gene ID216350
-
Molecular Construction
-
N-term
-
His
-
(G106-N203)
Accession # Q8R3G9-1 -
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
Tspan8; Tetraspanin-8; Tspan-8; TM4SF3; TSPAN8; Tumor-associated antigen CO-029; Transmembrane 4 superfamily member 3; CO-029
-
AA Sequence
GAAFKPEYNRILNETLYENAKLLSDNTDEAKDFQKAMIVFQSEFKCCGLENGAADWGNNFVEAKESCQCTGTDCATYQGSSVYPKTCLSLIKDLFEKN
-
Predicted Molecular Mass
12.8 kDa
-
Molecular Weight
Approximately 15-19 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
