TWEAK/TNFSF12 Protein, Human (HEK293, hFc)

TWEAK/TNFSF12 Protein binds to FN14 and potentially TNRFSF12/APO3, weakly inducing apoptosis in certain cells. It activates NF-kappa-B, enhances angiogenesis, and stimulates endothelial cell proliferation. Furthermore, TWEAK/TNFSF12 is implicated in inflammatory cytokine induction and promotes IL8 secretion. It forms a homotrimer and interacts with the angiogenic factor AGGF1/VG5Q. TWEAK/TNFSF12 Protein, Human (HEK293, hFc) is the recombinant human-derived TWEAK/TNFSF12 protein, expressed by HEK293 , with C-hFc labeled tag.

The TWEAK/TNFSF12 Protein exhibits binding affinity for FN14 and potentially TNRFSF12/APO3, functioning as a weak inducer of apoptosis in certain cell types. Additionally, TWEAK/TNFSF12 is involved in NF-kappa-B activation, thereby mediating multiple cellular responses, including angiogenesis and the proliferation of endothelial cells. Its role extends to the induction of inflammatory cytokines and the promotion of IL8 secretion. As a homotrimer, TWEAK/TNFSF12 likely engages in intricate molecular interactions to orchestrate its diverse functions. Furthermore, it interacts with the angiogenic factor AGGF1/VG5Q, further underscoring its involvement in angiogenesis and its potential as a regulator of cellular processes with implications for inflammation and vascular homeostasis.

Immobilized Human TNFSF12, hFc Tag at 5 μg/mL (100 μl/well) on the plate. Dose response curve for Biotinylated Anti-TNFSF12 Antibody, hFc Tag with the EC₅₀ of ≤0.11 μg/mL determined by ELISA.

Human

HEK293

C-hFc

O43508-1/NP_003800.1 (S43-H249)

8742  [NCBI]

Extracellular Domain

SLGSRASLSAQEPAQEELVAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLKLDLLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH

Approximately 50-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, 200 mM L-arginine, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.