Copy Link Print Information

TWEAK/TNFSF12 Protein, Human (HEK293, hFc)

Customer Review

Based on 1 Customer Validation

TWEAK/TNFSF12 Protein binds to FN14 and potentially TNRFSF12/APO3, weakly inducing apoptosis in certain cells. It activates NF-kappa-B, enhances angiogenesis, and stimulates endothelial cell proliferation. Furthermore, TWEAK/TNFSF12 is implicated in inflammatory cytokine induction and promotes IL8 secretion. It forms a homotrimer and interacts with the angiogenic factor AGGF1/VG5Q. TWEAK/TNFSF12 Protein, Human (HEK293, hFc) is the recombinant human-derived TWEAK/TNFSF12 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • TWEAK/TNFSF12 Protein, Human (HEK293, hFc) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

TWEAK/TNFSF12 Protein binds to FN14 and potentially TNRFSF12/APO3, weakly inducing apoptosis in certain cells. It activates NF-kappa-B, enhances angiogenesis, and stimulates endothelial cell proliferation. Furthermore, TWEAK/TNFSF12 is implicated in inflammatory cytokine induction and promotes IL8 secretion. It forms a homotrimer and interacts with the angiogenic factor AGGF1/VG5Q. TWEAK/TNFSF12 Protein, Human (HEK293, hFc) is the recombinant human-derived TWEAK/TNFSF12 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

The TWEAK/TNFSF12 Protein exhibits binding affinity for FN14 and potentially TNRFSF12/APO3, functioning as a weak inducer of apoptosis in certain cell types. Additionally, TWEAK/TNFSF12 is involved in NF-kappa-B activation, thereby mediating multiple cellular responses, including angiogenesis and the proliferation of endothelial cells. Its role extends to the induction of inflammatory cytokines and the promotion of IL8 secretion. As a homotrimer, TWEAK/TNFSF12 likely engages in intricate molecular interactions to orchestrate its diverse functions. Furthermore, it interacts with the angiogenic factor AGGF1/VG5Q, further underscoring its involvement in angiogenesis and its potential as a regulator of cellular processes with implications for inflammation and vascular homeostasis.

Verified Bioactivity

Immobilized Human TNFSF12, hFc Tag at 5 μg/mL (100 μl/well) on the plate. Dose response curve for Biotinylated Anti-TNFSF12 Antibody, hFc Tag with the EC50 of ≤0.11 μg/mL determined by ELISA.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-hFc
  • Accession

    O43508-1/NP_003800.1 (S43-H249)

  • Gene ID
    8742  [NCBI]
  • Molecular Construction
    • N-term
    • TWEAK (S43-H249)
      Accession # O43508-1
    • hFc
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    TNFSF12; TNLG4A; TNF Superfamily Member 12; TNF12; TWEAK; Tumor Necrosis Factor Superfamily Member 12; DR3LG; TNF-Related WEAK Inducer Of Apoptosis; APO3L; Tumor Necrosis Factor Ligand 4A; Tumor Necrosis Factor Ligand Superfamily Member 12; HCG1991317, Is

  • AA Sequence

    SLGSRASLSAQEPAQEELVAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLKLDLLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH

  • Predicted Molecular Mass

    49.6 kDa

  • Molecular Weight

    Approximately 50-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 200 mM L-arginine, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • TWEAK/TNFSF12 Protein, Human (HEK293, hFc) Product Image
    1/16
  • TWEAK/TNFSF12 Protein, Human (HEK293, hFc) Product Image