1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TNF Superfamily
  4. TNF Superfamily Ligands
  5. TWEAK Proteins
  6. TWEAK/TNFSF12 Protein, Human (HEK293, hFc)

TWEAK/TNFSF12 Protein binds to FN14 and potentially TNRFSF12/APO3, weakly inducing apoptosis in certain cells. It activates NF-kappa-B, enhances angiogenesis, and stimulates endothelial cell proliferation. Furthermore, TWEAK/TNFSF12 is implicated in inflammatory cytokine induction and promotes IL8 secretion. It forms a homotrimer and interacts with the angiogenic factor AGGF1/VG5Q. TWEAK/TNFSF12 Protein, Human (HEK293, hFc) is the recombinant human-derived TWEAK/TNFSF12 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

TWEAK/TNFSF12 Protein binds to FN14 and potentially TNRFSF12/APO3, weakly inducing apoptosis in certain cells. It activates NF-kappa-B, enhances angiogenesis, and stimulates endothelial cell proliferation. Furthermore, TWEAK/TNFSF12 is implicated in inflammatory cytokine induction and promotes IL8 secretion. It forms a homotrimer and interacts with the angiogenic factor AGGF1/VG5Q. TWEAK/TNFSF12 Protein, Human (HEK293, hFc) is the recombinant human-derived TWEAK/TNFSF12 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

The TWEAK/TNFSF12 Protein exhibits binding affinity for FN14 and potentially TNRFSF12/APO3, functioning as a weak inducer of apoptosis in certain cell types. Additionally, TWEAK/TNFSF12 is involved in NF-kappa-B activation, thereby mediating multiple cellular responses, including angiogenesis and the proliferation of endothelial cells. Its role extends to the induction of inflammatory cytokines and the promotion of IL8 secretion. As a homotrimer, TWEAK/TNFSF12 likely engages in intricate molecular interactions to orchestrate its diverse functions. Furthermore, it interacts with the angiogenic factor AGGF1/VG5Q, further underscoring its involvement in angiogenesis and its potential as a regulator of cellular processes with implications for inflammation and vascular homeostasis.

Biological Activity

Immobilized Human TNFSF12, hFc Tag at 5 μg/mL (100 μl/well) on the plate. Dose response curve for Biotinylated Anti-TNFSF12 Antibody, hFc Tag with the EC50 of ≤0.11 μg/mL determined by ELISA.

Species

Human

Source

HEK293

Tag

C-hFc

Accession

O43508-1/NP_003800.1 (S43-H249)

Gene ID
Molecular Construction
N-term
TWEAK (S43-H249)
Accession # O43508-1
hFc
C-term
Protein Length

Extracellular Domain

Synonyms
APO3 ligand; APO3L; DR3LG; UNQ181/PRO207; TWEAK; MGC129581
AA Sequence

SLGSRASLSAQEPAQEELVAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLKLDLLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH

Predicted Molecular Mass
49.6 kDa
Molecular Weight

Approximately 50-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 200 mM L-arginine, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

TWEAK/TNFSF12 Protein, Human (HEK293, hFc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

TWEAK/TNFSF12 Protein, Human (HEK293, hFc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
TWEAK/TNFSF12 Protein, Human (HEK293, hFc)
Cat. No.:
HY-P701045
Quantity:
MCE Japan Authorized Agent: