UbcH6/UBE2E1 Protein, Human (sf9, His, StrepⅡ)
The UbcH6/UBE2E1 protein is an important ubiquitination component that acts as an E2 ubiquitin-conjugating enzyme, accepting ubiquitin in the E1 complex and catalyzing its covalent attachment to proteins. It is versatile and also facilitates covalent attachment of ISG15, playing a role in a variety of ubiquitin-like modifications. UbcH6/UBE2E1 Protein, Human (sf9, His, Strep) is the recombinant human-derived UbcH6/UBE2E1 protein, expressed by sf9 insect cells , with N-Strep, N-8*His labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The UbcH6/UBE2E1 protein is an important ubiquitination component that acts as an E2 ubiquitin-conjugating enzyme, accepting ubiquitin in the E1 complex and catalyzing its covalent attachment to proteins. It is versatile and also facilitates covalent attachment of ISG15, playing a role in a variety of ubiquitin-like modifications. UbcH6/UBE2E1 Protein, Human (sf9, His, Strep) is the recombinant human-derived UbcH6/UBE2E1 protein, expressed by sf9 insect cells , with N-Strep, N-8*His labeled tag.
Background
UbcH6/UBE2E1, a pivotal component of the ubiquitination machinery, functions as an E2 ubiquitin-conjugating enzyme by accepting ubiquitin from the E1 complex and catalyzing its covalent attachment to other proteins. Notably versatile, this enzyme also facilitates the covalent attachment of ISG15 to other proteins, highlighting its role in diverse ubiquitin-like modifications. Beyond conventional ubiquitination, UbcH6/UBE2E1 plays a crucial role in the selective degradation of short-lived and abnormal proteins, contributing to cellular quality control mechanisms. Furthermore, in vitro studies demonstrate its ability to catalyze 'Lys-48'-linked polyubiquitination, underscoring its involvement in the regulation of protein stability and turnover.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag N-StrepⅡ;N-8*His
-
Accession
P51965 (S2-T193)
-
Gene ID7324
-
Molecular Construction
-
N-term
-
8*His-StrepⅡ
-
UbcH6 (S2-T193)
Accession # P51965 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
UBE2E1; Ubiquitin Conjugating Enzyme E2 E1; UbcH6; Ubiquitin-Conjugating Enzyme E2E 1 (Homologous To Yeast UBC4/5); Ubiquitin-Conjugating Enzyme E2E 1 (UBC4/5 Homolog,Yeast); (E3-Independent) E2 Ubiquitin-Conjugating Enzyme E1; Ubiquitin-Conjugating Enzym
-
AA Sequence
SDDDSRASTSSSSSSSSNQQTEKETNTPKKKESKVSMSKNSKLLSTSAKRIQKELADITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFTPEYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEHDRMARQWTKRYAT
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
