1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. UBE2C Protein, Human (sf9, His, StrepⅡ)

The UBE2C protein is a key ubiquitin-proteasome system component that acts as an E2 ubiquitin-conjugating enzyme and is the core of the covalent linkage of ubiquitin to target proteins. In vitro, UBE2C expertly promotes “Lys-11” and “Lys-48” linked polyubiquitination, demonstrating the versatility of ubiquitin chain formation. UBE2C Protein, Human (sf9, His, Strep) is the recombinant human-derived UBE2C protein, expressed by sf9 insect cells , with N-Strep, N-8*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The UBE2C protein is a key ubiquitin-proteasome system component that acts as an E2 ubiquitin-conjugating enzyme and is the core of the covalent linkage of ubiquitin to target proteins. In vitro, UBE2C expertly promotes “Lys-11” and “Lys-48” linked polyubiquitination, demonstrating the versatility of ubiquitin chain formation. UBE2C Protein, Human (sf9, His, Strep) is the recombinant human-derived UBE2C protein, expressed by sf9 insect cells , with N-Strep, N-8*His labeled tag.

Background

UBE2C, a pivotal component of the ubiquitin-proteasome system, functions as an E2 ubiquitin-conjugating enzyme, playing a central role in the covalent attachment of ubiquitin to target proteins. In vitro, UBE2C demonstrates catalytic proficiency in facilitating 'Lys-11'- and 'Lys-48'-linked polyubiquitination, showcasing its versatility in ubiquitin chain formation. Crucially, UBE2C acts as an indispensable factor in the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated ubiquitin ligase pivotal for governing mitotic progression. Its role in initiating 'Lys-11'-linked polyubiquitin chains on APC/C substrates underscores its significance in orchestrating the degradation of specific proteins by the proteasome, thereby promoting a timely and controlled exit from mitosis.

Biological Activity

The ubiquitin conjugating activity of UBE2C was validated through its ability to catalyse the generation of polyubiquitin chains in the presence of the E1 activating enzyme UBE1 and Bodipyubiquitin. Incubation of UBE2C for 60 minutes at 37˚C in the presence of Bodipy-ubiquitin, UBE1 and ATP was compared alongside two control reactions with either ATP or UBE2C excluded from the reaction. Ubiquitin conjugates were identified by the migration of the Bodipy-ubiquitin band and these were observed only in the presence of ATP and UBE2C.

Species

Human

Source

Sf9 insect cells

Tag

N-StrepⅡ;N-8*His

Accession

O00762 (A2-P179)

Gene ID

11065

Molecular Construction
N-term
8*His-StrepⅡ
UBE2C (A2-P179)
Accession # O00762
C-term
Protein Length

Full Length

Synonyms
UBE2C; Ubiquitin-conjugating enzyme E2 C; (E3-independent) E2 ubiquitin-conjugating enzyme C; E2 ubiquitin-conjugating enzyme C; UbcH10; Ubiquitin carrier protein C; Ubiquitin-protein ligase C
AA Sequence

ASQNRDPAATSVAAARKGAEPSGGAARGPVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNPTAFKKYLQETYSKQVTSQEP

Predicted Molecular Mass
22.7 kDa
Molecular Weight

Approximately 23 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 85%, as determined by reducing SDS-PAGE.

Appearance

Solution

Formulation

1.Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, pH 7.5, 200 mM NaCl, 20% glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
2.Supplied as a 0.22 μm filtered solution of 50 mM HEPES, pH 7.5, 200 mM NaCl, 20% glycerol, 1 mM DTT.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

UBE2C Protein, Human (sf9, His, StrepⅡ) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

UBE2C Protein, Human (sf9, His, StrepⅡ)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
UBE2C Protein, Human (sf9, His, StrepⅡ)
Cat. No.:
HY-P701350
Quantity:
MCE Japan Authorized Agent: