UBE2C Protein, Human (sf9, His, StrepⅡ)
Based on 1 Customer Validation
The UBE2C protein is a key ubiquitin-proteasome system component that acts as an E2 ubiquitin-conjugating enzyme and is the core of the covalent linkage of ubiquitin to target proteins. In vitro, UBE2C expertly promotes “Lys-11” and “Lys-48” linked polyubiquitination, demonstrating the versatility of ubiquitin chain formation. UBE2C Protein, Human (sf9, His, Strep) is the recombinant human-derived UBE2C protein, expressed by sf9 insect cells , with N-Strep, N-8*His labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The UBE2C protein is a key ubiquitin-proteasome system component that acts as an E2 ubiquitin-conjugating enzyme and is the core of the covalent linkage of ubiquitin to target proteins. In vitro, UBE2C expertly promotes “Lys-11” and “Lys-48” linked polyubiquitination, demonstrating the versatility of ubiquitin chain formation. UBE2C Protein, Human (sf9, His, Strep) is the recombinant human-derived UBE2C protein, expressed by sf9 insect cells , with N-Strep, N-8*His labeled tag.
Background
UBE2C, a pivotal component of the ubiquitin-proteasome system, functions as an E2 ubiquitin-conjugating enzyme, playing a central role in the covalent attachment of ubiquitin to target proteins. In vitro, UBE2C demonstrates catalytic proficiency in facilitating 'Lys-11'- and 'Lys-48'-linked polyubiquitination, showcasing its versatility in ubiquitin chain formation. Crucially, UBE2C acts as an indispensable factor in the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated ubiquitin ligase pivotal for governing mitotic progression. Its role in initiating 'Lys-11'-linked polyubiquitin chains on APC/C substrates underscores its significance in orchestrating the degradation of specific proteins by the proteasome, thereby promoting a timely and controlled exit from mitosis.
Verified Bioactivity
The ubiquitin conjugating activity of UBE2C was validated through its ability to catalyse the generation of polyubiquitin chains in the presence of the E1 activating enzyme UBE1 and Bodipyubiquitin. Incubation of UBE2C for 60 minutes at 37˚C in the presence of Bodipy-ubiquitin, UBE1 and ATP was compared alongside two control reactions with either ATP or UBE2C excluded from the reaction. Ubiquitin conjugates were identified by the migration of the Bodipy-ubiquitin band and these were observed only in the presence of ATP and UBE2C.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag N-StrepⅡ;N-8*His
-
Accession
O00762 (A2-P179)
-
Gene ID11065
-
Molecular Construction
-
N-term
-
8*His-StrepⅡ
-
UBE2C (A2-P179)
Accession # O00762 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
UBE2C; Ubiquitin Conjugating Enzyme E2 C; UBCH10; (E3-Independent) E2 Ubiquitin-Conjugating Enzyme C; Ubiquitin-Conjugating Enzyme E2 C; E2 Ubiquitin-Conjugating Enzyme C; Ubiquitin-Protein Ligase C; Ubiquitin Carrier Protein C; Ubiquitin-Conjugating Enzy
-
AA Sequence
ASQNRDPAATSVAAARKGAEPSGGAARGPVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNPTAFKKYLQETYSKQVTSQEP
-
Predicted Molecular Mass
22.7 kDa
-
Molecular Weight
Approximately 23 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Solution
1.Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, pH 7.5, 200 mM NaCl, 20% glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
2.Supplied as a 0.22 μm filtered solution of 50 mM HEPES, pH 7.5, 200 mM NaCl, 20% glycerol, 1 mM DTT.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (237 KB)
-
SDS (311 KB)
- English - EN (311 KB)
- Français - FR (311 KB)
- Deutsch - DE (311 KB)
- Norwegian - NO (311 KB)
- Español - ES (311 KB)
- Swedish - SV (311 KB)
- Italian - IT (311 KB)
- Korean - KR (311 KB)
- Portuguese - PT (311 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
