ULBP2/NKG2DL2 Protein, Human (HEK293, hFc)
NKG2DL2 Protein activates KLRK1/NKG2D receptor, promoting natural killer cell cytotoxicity. Importantly, it does not bind beta2-microglobulin, confirmed by research findings. ULBP2/NKG2DL2 Protein, Human (HEK293, hFc) is the recombinant human-derived ULBP2/NKG2DL2 protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
NKG2DL2 Protein activates KLRK1/NKG2D receptor, promoting natural killer cell cytotoxicity. Importantly, it does not bind beta2-microglobulin, confirmed by research findings. ULBP2/NKG2DL2 Protein, Human (HEK293, hFc) is the recombinant human-derived ULBP2/NKG2DL2 protein, expressed by HEK293 , with C-hFc labeled tag.
Background
The NKG2DL2 protein functions by binding to and activating the KLRK1/NKG2D receptor, thereby facilitating natural killer cell cytotoxicity. Its interaction with KLRK1/NKG2D has been documented. Notably, this protein does not exhibit binding affinity to beta2-microglobulin, as indicated by research findings.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-hFc
-
Accession
Q9BZM5 (G26-S216)
-
Molecular Construction
-
N-term
-
ULBP2 (G26-S216)
Accession # Q9BZM5 -
hFc
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
ULBP2; UL16 Binding Protein 2; RAET1H; Retinoic Acid Early Transcript 1H; UL16-Binding Protein 2; NKG2D Ligand 2; ALCAN-Alpha; NKG2DL2; N2DL2; N2DL-2
-
AA Sequence
GRADPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVSPLGKKLNVTTAWKAQNPVLREVVDILTEQLRDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSFDGQIFLLFDSEKRMWTTVHPGARKMKEKWENDKVVAMSFHYFSMGDCIGWLEDFLMGMDSTLEPSAGAPLAMS
-
Predicted Molecular Mass
48.4 kDa
-
Molecular Weight
Approximately 55-65 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
