UNC5H1 Protein, Human (HEK293, His)
Based on 1 Customer Validation
UNC5H1, a netrin receptor, critically guides axons, promoting neurite outgrowth in response to NTN1. It mediates axon repulsion in growth cones and induces apoptosis when unbound to netrin. UNC5H1 forms homodimers, homooligomers, and interacts with DCC, MAGED1, PRKCABP, FLRT2, and FLRT3, highlighting its multifaceted role in axon guidance and apoptosis during neural development. UNC5H1 Protein, Human (HEK293, His) is the recombinant human-derived UNC5H1 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
UNC5H1, a netrin receptor, critically guides axons, promoting neurite outgrowth in response to NTN1. It mediates axon repulsion in growth cones and induces apoptosis when unbound to netrin. UNC5H1 forms homodimers, homooligomers, and interacts with DCC, MAGED1, PRKCABP, FLRT2, and FLRT3, highlighting its multifaceted role in axon guidance and apoptosis during neural development. UNC5H1 Protein, Human (HEK293, His) is the recombinant human-derived UNC5H1 protein, expressed by HEK293 , with C-His labeled tag.
Background
UNC5H1 serves as a pivotal receptor for netrin, playing a crucial role in axon guidance and promoting neurite outgrowth in response to NTN1. Within the netrin signaling pathway, it functions to mediate axon repulsion in neuronal growth cones during nervous system development in response to netrin. The association with DCC is implicated in triggering signaling pathways leading to axon repulsion. Additionally, UNC5H1 acts as a dependence receptor, inducing apoptosis when not bound to netrin ligand. The receptor forms homodimers and homooligomers and interacts with various proteins, including the cytoplasmic part of DCC, MAGED1, PRKCABP, FLRT2, and FLRT3. These intricate interactions underscore UNC5H1's multifaceted role in orchestrating axon guidance and apoptotic responses in neural development.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
Q6ZN44-1/NP_588610.2 (Q26-Y306)
-
Molecular Construction
-
N-term
-
UNC5H1 (Q26-Y306)
Accession # Q6ZN44-1/NP_588610.2 -
His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
UNC5A; Unc-5 Netrin Receptor A; UNC5H1; KIAA1976; Unc5 (C.Elegans Homolog) A; Protein Unc-5 Homolog 1; Protein Unc-5 Homolog A; Netrin Receptor UNC5A; Unc-5 Homolog A (C. Elegans); Netrin Receptor Unc5h1; Netrin Receptor UNC5; Unc-5 Homolog 1; Unc-5 Homol
-
AA Sequence
QQSATVANPVPGANPDLLPHFLVEPEDVYIVKNKPVLLVCKAVPATQIFFKCNGEWVRQVDHVIERSTDGSSGLPTMEVRINVSRQQVEKVFGLEEYWCQCVAWSSSGTTKSQKAYIRIAYLRKNFEQEPLAKEVSLEQGIVLPCRPPEGIPPAEVEWLRNEDLVDPSLDPNVYITREHSLVVRQARLADTANYTCVAKNIVARRRSASAAVIVYVDGSWSPWSKWSACGLDCTHWRSRECSDPAPRNGGEECQGTDLDTRNCTSDLCVHTASGPEDVALY
-
Predicted Molecular Mass
32.7 kDa
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.2 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
