1. Recombinant Proteins
  2. Receptor Proteins
  3. UNC5H1 Protein, Human (HEK293, Fc)

UNC5H1, a netrin receptor, critically guides axons, promoting neurite outgrowth in response to NTN1. It mediates axon repulsion in growth cones and induces apoptosis when unbound to netrin. UNC5H1 forms homodimers, homooligomers, and interacts with DCC, MAGED1, PRKCABP, FLRT2, and FLRT3, highlighting its multifaceted role in axon guidance and apoptosis during neural development. UNC5H1 Protein, Human (HEK293, Fc) is the recombinant human-derived UNC5H1 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

UNC5H1, a netrin receptor, critically guides axons, promoting neurite outgrowth in response to NTN1. It mediates axon repulsion in growth cones and induces apoptosis when unbound to netrin. UNC5H1 forms homodimers, homooligomers, and interacts with DCC, MAGED1, PRKCABP, FLRT2, and FLRT3, highlighting its multifaceted role in axon guidance and apoptosis during neural development. UNC5H1 Protein, Human (HEK293, Fc) is the recombinant human-derived UNC5H1 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

UNC5H1 serves as a pivotal receptor for netrin, playing a crucial role in axon guidance and promoting neurite outgrowth in response to NTN1. Within the netrin signaling pathway, it functions to mediate axon repulsion in neuronal growth cones during nervous system development in response to netrin. The association with DCC is implicated in triggering signaling pathways leading to axon repulsion. Additionally, UNC5H1 acts as a dependence receptor, inducing apoptosis when not bound to netrin ligand. The receptor forms homodimers and homooligomers and interacts with various proteins, including the cytoplasmic part of DCC, MAGED1, PRKCABP, FLRT2, and FLRT3. These intricate interactions underscore UNC5H1's multifaceted role in orchestrating axon guidance and apoptotic responses in neural development.

Species

Human

Source

HEK293

Tag

C-hFc

Accession

Q6ZN44-1/NP_588610.2 (Q26-Y306)

Gene ID
Molecular Construction
N-term
UNC5H1 (Q26-Y306)
Accession # Q6ZN44-1/NP_588610.2
hFc
C-term
Protein Length

Extracellular Domain

Synonyms
Netrin receptor UNC5A; Protein unc-5 homolog 1; KIAA1976; UNC5A
AA Sequence

QQSATVANPVPGANPDLLPHFLVEPEDVYIVKNKPVLLVCKAVPATQIFFKCNGEWVRQVDHVIERSTDGSSGLPTMEVRINVSRQQVEKVFGLEEYWCQCVAWSSSGTTKSQKAYIRIAYLRKNFEQEPLAKEVSLEQGIVLPCRPPEGIPPAEVEWLRNEDLVDPSLDPNVYITREHSLVVRQARLADTANYTCVAKNIVARRRSASAAVIVYVDGSWSPWSKWSACGLDCTHWRSRECSDPAPRNGGEECQGTDLDTRNCTSDLCVHTASGPEDVALY

Predicted Molecular Mass
58.3 kDa
Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

UNC5H1 Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

UNC5H1 Protein, Human (HEK293, Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
UNC5H1 Protein, Human (HEK293, Fc)
Cat. No.:
HY-P76692
Quantity:
MCE Japan Authorized Agent: