VRK1 Protein, Human (sf9)

The VRK1 protein is a serine/threonine kinase that complexly regulates the cell cycle, nuclear condensation, and transcription. It critically induces Golgi disassembly during the cell cycle via PLK3 phosphorylation, thereby affecting Golgi fragmentation. VRK1 Protein, Human (sf9) is the recombinant human-derived VRK1 protein, expressed by Sf9 insect cells, with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The VRK1 protein is a serine/threonine kinase that complexly regulates the cell cycle, nuclear condensation, and transcription. It critically induces Golgi disassembly during the cell cycle via PLK3 phosphorylation, thereby affecting Golgi fragmentation. VRK1 Protein, Human (sf9) is the recombinant human-derived VRK1 protein, expressed by Sf9 insect cells, with tag free.

Background

VRK1, a serine/threonine kinase, intricately participates in cell cycle regulation, nuclear condensation, and transcriptional control. Through its diverse functions, VRK1 exhibits a multifaceted impact on cellular processes. Notably, it plays a crucial role in Golgi disassembly during the cell cycle, a process initiated by phosphorylation from PLK3 during mitosis, ultimately leading to Golgi fragmentation. VRK1 further modulates the intricate network of p53/TP53, phosphorylating 'Thr-18' and potentially impeding the interaction between p53/TP53 and MDM2. In response to DNA damage, VRK1 phosphorylates KAT5, fostering its association with chromatin and enhancing histone acetyltransferase activity. Moreover, VRK1 influences nuclear dynamics by phosphorylating BANF1, disrupting its DNA-binding capability, reducing its interaction with LEM domain-containing proteins, and triggering its relocalization from the nucleus to the cytoplasm. Additionally, VRK1 targets ATF2, activating its transcriptional activity and further expanding the regulatory repertoire of this versatile kinase.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • Gly-Pro
    • VRK1 (M1-K396)
      Accession # Q99986
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    VRK1; VRK Serine/Threonine Kinase 1; Serine/Threonine-Protein Kinase VRK1; Vaccinia Related Kinase 1; Vaccinia-Related Kinase 1; Non-Specific Serine/Threonine Protein Kinase; Vaccinia Virus B1R-Related Kinase 1; HMNR10; PCH1A; PCH1

  • AA Sequence

    MPRVKAAQAGRQSSAKRHLAEQFAVGEIITDMAKKEWKVGLPIGQGGFGCIYLADMNSSESVGSDAPCVVKVEPSDNGPLFTELKFYQRAAKPEQIQKWIRTRKLKYLGVPKYWGSGLHDKNGKSYRFMIMDRFGSDLQKIYEANAKRFSRKTVLQLSLRILDILEYIHEHEYVHGDIKASNLLLNYKNPDQVYLVDYGLAYRYCPEGVHKEYKEDPKRCHDGTIEFTSIDAHNGVAPSRRGDLEILGYCMIQWLTGHLPWEDNLKDPKYVRDSKIRYRENIASLMDKCFPEKNKPGEIAKYMETVKLLDYTEKPLYENLRDILLQGLKAIGSKDDGKLDLSVVENGGLKAKTITKKRKKEIEESKEPGVEDTEWSNTQTEEAIQTRSRTRKRVQK

  • Predicted Molecular Mass

    45.6 kDa

  • Molecular Weight

    Approximately 47 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00