1. Recombinant Proteins
  2. Enzymes & Regulators Kinases
  3. Transferases (EC 2) Serine/Threonine Kinase Proteins CK1 Pseudokinases
  4. VRK Serine/Threonine Kinase 1 VRK
  5. VRK1 Protein, Human (sf9)

The VRK1 protein is a serine/threonine kinase that complexly regulates the cell cycle, nuclear condensation, and transcription. It critically induces Golgi disassembly during the cell cycle via PLK3 phosphorylation, thereby affecting Golgi fragmentation. VRK1 Protein, Human (sf9) is the recombinant human-derived VRK1 protein, expressed by Sf9 insect cells, with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The VRK1 protein is a serine/threonine kinase that complexly regulates the cell cycle, nuclear condensation, and transcription. It critically induces Golgi disassembly during the cell cycle via PLK3 phosphorylation, thereby affecting Golgi fragmentation. VRK1 Protein, Human (sf9) is the recombinant human-derived VRK1 protein, expressed by Sf9 insect cells, with tag free.

Background

VRK1, a serine/threonine kinase, intricately participates in cell cycle regulation, nuclear condensation, and transcriptional control. Through its diverse functions, VRK1 exhibits a multifaceted impact on cellular processes. Notably, it plays a crucial role in Golgi disassembly during the cell cycle, a process initiated by phosphorylation from PLK3 during mitosis, ultimately leading to Golgi fragmentation. VRK1 further modulates the intricate network of p53/TP53, phosphorylating 'Thr-18' and potentially impeding the interaction between p53/TP53 and MDM2. In response to DNA damage, VRK1 phosphorylates KAT5, fostering its association with chromatin and enhancing histone acetyltransferase activity. Moreover, VRK1 influences nuclear dynamics by phosphorylating BANF1, disrupting its DNA-binding capability, reducing its interaction with LEM domain-containing proteins, and triggering its relocalization from the nucleus to the cytoplasm. Additionally, VRK1 targets ATF2, activating its transcriptional activity and further expanding the regulatory repertoire of this versatile kinase.

Species

Human

Source

Sf9 insect cells

Tag

Tag Free

Accession

Q99986 (N-G&P, M1-K396)

Gene ID
Molecular Construction
N-term
Gly-Pro
VRK1 (M1-K396)
Accession # Q99986
C-term
Protein Length

Full Length

Synonyms
Serine/threonine-protein kinase VRK1; Vaccinia-related kinase 1; VRK1
AA Sequence

MPRVKAAQAGRQSSAKRHLAEQFAVGEIITDMAKKEWKVGLPIGQGGFGCIYLADMNSSESVGSDAPCVVKVEPSDNGPLFTELKFYQRAAKPEQIQKWIRTRKLKYLGVPKYWGSGLHDKNGKSYRFMIMDRFGSDLQKIYEANAKRFSRKTVLQLSLRILDILEYIHEHEYVHGDIKASNLLLNYKNPDQVYLVDYGLAYRYCPEGVHKEYKEDPKRCHDGTIEFTSIDAHNGVAPSRRGDLEILGYCMIQWLTGHLPWEDNLKDPKYVRDSKIRYRENIASLMDKCFPEKNKPGEIAKYMETVKLLDYTEKPLYENLRDILLQGLKAIGSKDDGKLDLSVVENGGLKAKTITKKRKKEIEESKEPGVEDTEWSNTQTEEAIQTRSRTRKRVQK

Predicted Molecular Mass
45.6 kDa
Molecular Weight

Approximately 47 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

VRK1 Protein, Human (sf9)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
VRK1 Protein, Human (sf9)
Cat. No.:
HY-P77504
Quantity:
MCE Japan Authorized Agent: