1. Peptides
  2. Human growth hormone-releasing factor

Human growth hormone-releasing factor (Synonyms: Growth Hormone Releasing Factor human)

Cat. No.: HY-P0089 Purity: 98.28%
Handling Instructions

Human growth hormone-releasing factor stimulates GH production and release by binding to the GHRH Receptor (GHRHR) on cells in the anterior pituitary.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

Human growth hormone-releasing factor Chemical Structure

Human growth hormone-releasing factor Chemical Structure

CAS No. : 83930-13-6

Size Price Stock Quantity
500 μg USD 180 In-stock
Estimated Time of Arrival: December 31
1 mg USD 264 In-stock
Estimated Time of Arrival: December 31
5 mg USD 924 In-stock
Estimated Time of Arrival: December 31
10 mg USD 1440 In-stock
Estimated Time of Arrival: December 31
50 mg   Get quote  
100 mg   Get quote  

* Please select Quantity before adding items.

Customer Review

Based on 1 publication(s) in Google Scholar

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • Customer Review

Description

Human growth hormone-releasing factor stimulates GH production and release by binding to the GHRH Receptor (GHRHR) on cells in the anterior pituitary.

Molecular Weight

5039.65

Formula

C₂₁₅H₃₅₈N₇₂O₆₆S

CAS No.

83930-13-6

Sequence

Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu-NH2

Sequence Shortening

YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2

Shipping

Room temperature in continental US; may vary elsewhere.

Storage
Powder -80°C 2 years
  -20°C 1 year
In solvent -80°C 6 months
  -20°C 1 month
Solvent & Solubility
In Vitro: 

H2O : 25 mg/mL (4.96 mM; Need ultrasonic and warming)

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.1984 mL 0.9921 mL 1.9843 mL
5 mM --- --- ---
10 mM --- --- ---
*Please refer to the solubility information to select the appropriate solvent.
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Keywords:

Human growth hormone-releasing factorGrowth Hormone Releasing Factor humanOthersInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product name

 

Salutation

Applicant name *

 

Email address *

Phone number *

 

Organization name *

Country or Region *

 

Requested quantity *

Remarks

Bulk Inquiry

Inquiry Information

Product name:
Human growth hormone-releasing factor
Cat. No.:
HY-P0089
Quantity:
MCE Japan Authorized Agent: