C-Type Natriuretic Peptide (1-53), Porcine, Rat,mouse
C-Type Natriuretic Peptide (1-53), Porcine, Rat, mouse is an activator of particulate guanylate cyclase B (pGC-B), which is highly expressed in endothelial cells, kidneys, and the heart. C-Type Natriuretic Peptide (1-53), Porcine, Rat, mouse can mediate a potent anti-fibrotic effect in human cardiac and renal fibroblasts by generating the second messenger cGMP.
For research use only. We do not sell to patients.
- CAS No.: 129405-72-7
- Formula: C251H414N82O70S3
- Molecular Weight:5796.68
-
Storage:
Please store the product under the recommended conditions in the Certificate of Analysis.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Chemical Information
- Purity & Documentation
- References
-
Help & FAQs
All Endogenous Metabolite Isoforms
More
Biological Activity
Description
Chemical Information
-
CAS No. 129405-72-7
-
Molecular Weight 5796.68
-
Formula C251H414N82O70S3
-
Sequence
Asp-Leu-Arg-Val-Asp-Thr-Lys-Ser-Arg-Ala-Ala-Trp-Ala-Arg-Leu-Leu-His-Glu-His-Pro-Asn-Ala-Arg-Lys-Tyr-Lys-Gly-Gly-Asn-Lys-Lys-Gly-Leu- Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu-Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys (Disulfidebridge:Cys37-Cys53)
-
Sequence Shortening
DLRVDTKSRAAWARLLHEHPNARKYKGGNKKGLSKGCFGLKLDRIGSMSGLGC (Disulfidebridge:Cys37-Cys53)
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
C-Type Natriuretic Peptide (1-53), Porcine, Rat,mouse Related Classifications
HY-P10720 Related Classifications
Powered by Bioz