Stromatoxin 1
Stromatoxin 1 is an inhibitor of Potassium Channel, a peptide which can be isolated from tarantulas. Stromatoxin 1 selectively inhibits K(V)2.1, K(V)2.2, K(V)4.2, and K(V)2.1/9.3 channels. K(V)2.1 and K(V)2.2, but not K(V)4.2, channel subunits play a key role in opposing both myogenic and neurogenic urinary bladder smooth muscle (UBSM) contractions in rats.
Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.
- CAS. Nr.: 741738-59-0
- Formel: C156H237N49O48S7
- Molecular Weight:3791.31
-
Speicherung:
Please store the product under the recommended conditions in the Certificate of Analysis.
Biologische Aktivität
Beschreibung
IC50 & Target
K(V)2.1, K(V)2.2, K(V)4.2, and K(V)2.1/9.3[1]
Chemical Information
-
CAS. Nr. 741738-59-0
-
Molecular Weight 3791.31
-
Formel C156H237N49O48S7
-
Sequence
Asp-Cys-Thr-Arg-Met-Phe-Gly-Ala-Cys-Arg-Arg-Asp-Ser-Asp-Cys-Cys-Pro-His-Leu-Gly-Cys-Lys-Pro-Thr-Ser-Lys-Tyr-Cys-Ala-Trp-Asp-Gly-Thr-Ile-NH2 (Disulfide bridge: Cys2-Cys16, Cys9-Cys21, Cys15-Cys28)
-
Sequence Shortening
DCTRMFGACRRDSDCCPHLGCKPTSKYCAWDGTI-NH2 (Disulfide bridge: Cys2-Cys16, Cys9-Cys21, Cys15-Cys28)
-
Versand
Room temperature in continental US; may vary elsewhere.
-
Speicherung
Please store the product under the recommended conditions in the Certificate of Analysis.
Reinheit & Dokumentation
Verweise
Calculators
Konzentration (Stammlösung) × Volumen (Stammlösung) = Konzentration (Ziellösung) × Volumen (Ziellösung)