1. Recombinant Proteins
  2. Others
  3. Apolipoprotein A-I/APOA1 Protein, Human

Apolipoprotein A-I/APOA1 Protein is a secreted protein located on the outside of cell membranes and is the main structural apolipoprotein of high-density lipoprotein (HDL), playing a key role in the reverse cholesterol transport pathway. Apolipoprotein A-I/APOA1 protein interacts with the cell surface receptor SR-BI, thereby promoting dengue virus (DV) infection. Apolipoprotein A-I/APOA1 Protein can also activate sperm motility as part of the SPAP complex. Apolipoprotein A-I/APOA1 Protein has anti-inflammatory, anti-atherosclerotic, anti-apoptotic, anti-tumor, and anti-thrombotic functions. Apolipoprotein A-I/APOA1 Protein Protein, Human is made up of 267 amino acids and is expressed in Escherichia coli (E. coli).

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
10 μg 해외재고보유
50 μg 해외재고보유
100 μg 견적 받기
> 100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products

1 Publications Citing Use of MCE Apolipoprotein A-I/APOA1 Protein, Human

  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

  • References

제품 설명

Apolipoprotein A-I/APOA1 Protein is a secreted protein located on the outside of cell membranes and is the main structural apolipoprotein of high-density lipoprotein (HDL), playing a key role in the reverse cholesterol transport pathway. Apolipoprotein A-I/APOA1 protein interacts with the cell surface receptor SR-BI, thereby promoting dengue virus (DV) infection. Apolipoprotein A-I/APOA1 Protein can also activate sperm motility as part of the SPAP complex. Apolipoprotein A-I/APOA1 Protein has anti-inflammatory, anti-atherosclerotic, anti-apoptotic, anti-tumor, and anti-thrombotic functions. Apolipoprotein A-I/APOA1 Protein Protein, Human is made up of 267 amino acids and is expressed in Escherichia coli (E. coli)[1][2][3][4].

Background

Apolipoprotein A-I/APOA1 Protein is one of the most common proteins in human plasma, typically found in amounts of 100-150 mg/dl, with about 80% produced by the liver and 20% by the intestines[3].
The central region of Apolipoprotein A-I/APOA1 Protein (140-170 aa) is mainly associated with the activation of LCAT, while the C-terminal domain (181-243 aa) plays a key role in lipid binding[3].
Apolipoprotein A-I/APOA1 Protein plays a role in the reverse transport of cholesterol from tissues to the liver for excretion by promoting the flow of cholesterol out of tissues and acting as a cofactor for lecithin-cholesterol acyltransferase (LCAT), effectively protecting the body from the accumulation of cholesterol in tissues[1].
When Apolipoprotein A-I/APOA1 Protein interacts with SRB1, cell adhesion molecules are inhibited. This interaction introduces miRNA223 into endothelial cells, which suppresses the expression of ICAM and VCAM on the endothelial membrane and prevents monocytes from adhering to the endothelial cells, thus having an anti-inflammatory effect[3].
Apolipoprotein A-I/APOA1 protein can bridge DV particles and the cell receptor SR-BI, facilitating the attachment of DV to cells, which leads to viral infection[4].
Apolipoprotein A-I/APOA1 Protein is associated with diseases like viral infections, atherosclerosis, diabetes, neurological disorders, and tumors[3][4][5][6].

In Vitro

Apolipoprotein A-I/APOA1 Protein can transport cholesterol to steroidogenic tissues and remove excess free cholesterol from peripheral tissues, esterify it in plasma, and transport it to the liver for excretion[1].
Apolipoprotein A-I/APOA1 Protein (1.68 μg/mL, 30 min) interacts with cell surface receptor SR-BI to enhance the attachment of dengue virus (DV) to human liver cancer cell line Huh-7 and promote viral infection[4].
Apolipoprotein A-I/APOA1 Protein (100 μg/mL, 48 h) can inhibit the cell viability and proliferation of ID8 mouse epithelial cancer cells[6].

In Vivo

Apolipoprotein A-I/APOA1 Protein overexpression in human ApoA-I transgenic mice with apolipoprotein E (Apo E) gene knockout can increase high-density lipoprotein and inhibit atherosclerosis[5].
Apolipoprotein A-I/APOA1 Protein overexpression in human ApoA-I transgenic ovarian cancer mice confers anti-tumor activity[6].

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human APOA1 at 5 µg/mL (100 µL/well) can bind Biotinylated Human MSR (HY-P76781). The ED50 for this effect is 0.3-1.5 μg/mL.

  • Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human APOA1 at 5 µg/mL (100 µL/well) can bind Biotinylated Human MSR (HY-P76781). The ED50 for this effect is 0.5135 μg/mL.
Species

Human

Source

E. coli

Tag

Tag Free

Accession

P02647 (R19-Q267)

Gene ID

335  [NCBI]

Molecular Construction
N-term
APOA1 (R19-Q267)
Accession # P02647
C-term
Protein Length

Full Length of Mature Protein

Synonyms
rHuApolipoprotein A-I; ApoA1; Apolipoprotein A-I
AA Sequence

RHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ

Predicted Molecular Mass
28.96 kDa
분자량

Approximately 25-27 kDa, based on SDS-PAGE under reducing conditions.

Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.2.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류
References

Apolipoprotein A-I/APOA1 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

Apolipoprotein A-I/APOA1 Protein, Human

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
Apolipoprotein A-I/APOA1 Protein, Human
Cat. No.:
HY-P7526
수량:
MCE Japan Authorized Agent: