IL-37 Protein, Human
Based on 2 publication(s) in Google Scholar
IL-37 protein is an important immunoregulatory cytokine that suppresses innate inflammation and immune responses and reduces excessive inflammation. It signals intracellularly through nuclear translocation of SMAD3 and extracellularly through binding to its receptors, consisting of IL18R1 and IL18RAP. IL-37 Protein, Human is the recombinant human-derived IL-37 protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
IL-37 protein is an important immunoregulatory cytokine that suppresses innate inflammation and immune responses and reduces excessive inflammation. It signals intracellularly through nuclear translocation of SMAD3 and extracellularly through binding to its receptors, consisting of IL18R1 and IL18RAP. IL-37 Protein, Human is the recombinant human-derived IL-37 protein, expressed by E. coli , with tag free.
Background
IL-37 Protein, an immune regulatory cytokine, plays a pivotal role as a suppressor of innate inflammatory and immune responses, mitigating excessive inflammation. Signaling occurs through two distinct mechanisms: intracellularly via nuclear translocation with SMAD3 and extracellularly after secretion and binding to its receptor, composed of IL18R1 and IL18RAP. IL-37 suppresses or reduces the production of pro-inflammatory cytokines, including IL1A, IL6, CCL12, CSF1, CSF2, CXCL13, IL1B, IL23A, and IL1RN, while sparing anti-inflammatory cytokines. It also inhibits dendritic cell activation. IL-37 interacts with SMAD3 and binds IL18R1, albeit with lower affinity than IL18, without acting as a receptor antagonist for IL18. Additionally, it forms a complex with the cargo receptor TMED10, facilitating translocation from the cytoplasm into the endoplasmic reticulum-Golgi intermediate compartment (ERGIC) and subsequent secretion.
Verified Bioactivity
Immobilized Recombinant human IL-18 R alpha /IL-1 R5 at 2 μg/mL (100 μL/well) can bind Biotinylated Recombinant human IL-37 Protein. The ED50 for this effect is <512 ng/mL.
Publications (2)
-
Journal Impact Factor
-
Most Recent
-
Cardiovasc Res
Interleukin-37 attenuates aortic valve lesions by inhibiting m6A-mediated IRAK-M degradation. [Abstract]2025 Apr 29;121(3):492-506. PMID: 39913240 -
Oxid Med Cell Longev
Marine-Derived Piericidin Diglycoside S18 Alleviates Inflammatory Responses in the Aortic Valve via Interaction with Interleukin 37. [Abstract]2022 Aug 17:2022:6776050. PMID: 36035206
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
Q9NZH6-1 (K53-D218)
-
Molecular Construction
-
N-term
-
IL-37 (K53-D218)
Accession # Q9NZH6-1 -
C-term
-
-
Protein Length
Partial
-
Synonyms
IL37; IL1RP1; Prev. IL1F7; IL-37; IL-1RP1; IL1H4; IL-1H4; Interleukin 1 Family, Member 7 (Zeta); IL-1F7; IL1F7 (Canonical Product IL-1F7b); FIL1Z; IL-1F7b (IL-1H4, IL-1H, IL-1RP1); Interleukin-1-Related Protein; Interleukin 1 Family Member 7; Interleukin-
-
AA Sequence
KNLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFALASSLSSASAEKGSPILLGVSKGEFCLYCDKDKGQSHPSLQLKKEKLMKLAAQKESARRPFIFYRAQVGSWNMLESAAHPGWFICTSCNCNEPVGVTDKFENRKHIEFSFQPVCKAEMSPSEVSD
-
Predicted Molecular Mass
18.7 kDa
-
Molecular Weight
Approximately 18 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, 2 mM DTT, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (262 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)