IL-4 Protein, Porcine (CHO)
Based on 1 Customer Validation
IL-4 Protein, Porcine (CHO) is the prime anti-infalmmatory cytokine involves in cell proliferation, various gene expression and avert apoptosis in IL-4 expressing cells.
- Species: Porcine
- Source: CHO
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
IL-4 Protein, Porcine (CHO) is the prime anti-infalmmatory cytokine involves in cell proliferation, various gene expression and avert apoptosis in IL-4 expressing cells.
Background
The effect of IL-4 signaling is mediated through the IL-4 receptor alpha chain (IL-4Rα). Upon binding to its ligand, IL-4Rα dimerizes either with the common gamma chain (γc) to produce the type-1 signaling complex located mainly on hematopoietic cells, or with the IL-13 receptor alpha 1 (IL-13Rα1) to produce the type-2 complex, which is expressed also on non-hematopoietic cells[1].
Verified Bioactivity
The ED50 is <0.25 ng/mL as measured by TF-1 human erythroleukemic cells, corresponding to a specific activity of >4.0 × 106 units/mg.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Porcine
-
Source CHO
-
Tag Tag Free
-
Accession
Q04745 (H25-C133)
-
Molecular Construction
-
N-term
-
IL-4 (H25-C133)
Accession # Q04745 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
IL4; B_cell Stimulatory Factor 1; Interleukin 4; B-Cell Stimulatory Factor 1; IL-4; B Cell Growth Factor 1; Lymphocyte Stimulatory Factor 1; Binetrakin; Interleukin-4; Pitrakinra; BCGF-1; MGC79402; BCGF1; BSF-1; BSF1
-
AA Sequence
HKCDITLQEIIKTLNILTARKNSCMELPVTDVFAAPENTTEKETFCRASTVLRHIYRHHTCMKSLLSGLDRNLSSMANMTCSVHEAKKSTLKDFLERLKTIMKEKYSKC
-
Molecular Weight
Approximately 15 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS.
<0.2 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (260 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
