VEGF-C Protein, Human (HEK293, His-Avi)
Based on 1 Customer Validation
VEGF-C protein is an important member of the PDGF/VEGF growth factor family and plays a role in important cell signaling pathways. As part of this family, VEGF-C may share features with related proteins that promote cell growth, angiogenesis, and lymphangiogenesis. VEGF-C Protein, Human (HEK293, His-Avi) is the recombinant human-derived VEGF-C protein, expressed by HEK293 , with C-Avi, C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
VEGF-C protein is an important member of the PDGF/VEGF growth factor family and plays a role in important cell signaling pathways. As part of this family, VEGF-C may share features with related proteins that promote cell growth, angiogenesis, and lymphangiogenesis. VEGF-C Protein, Human (HEK293, His-Avi) is the recombinant human-derived VEGF-C protein, expressed by HEK293 , with C-Avi, C-His labeled tag.
Background
The VEGF-C Protein is a vital member of the PDGF/VEGF growth factor family, suggesting its involvement in essential cellular signaling pathways. As part of this growth factor family, VEGF-C likely shares structural and functional characteristics with related proteins, implicating its role in promoting cell growth, angiogenesis, and lymphangiogenesis. The membership in the PDGF/VEGF growth factor family highlights its significance in regulating vascular and lymphatic development. The study of VEGF-C contributes to our understanding of its specific functions within the context of the growth factor family, offering insights into potential therapeutic applications and its broader impact on cellular processes involved in tissue development and maintenance. Further exploration of VEGF-C's role can deepen our comprehension of its contribution to physiological and pathological conditions.
Verified Bioactivity
Immobilized Human VEGF-C, His Tag at 1 μg/mL (100 μl/well) on the plate. Dose response curve for Human VEGF R3, hFc Tag with the EC50 of <21.7 ng/mL determined by ELISA.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-Avi;C-8*His
-
Accession
Q6FH59 (T103-R227)
-
Gene ID7424
-
Molecular Construction
-
N-term
-
VEGF-C (T103-R227)
Accession # Q6FH59 -
8*His-Avi
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
VEGFC; Vascular Endothelial Growth Factor C; Vascular Endothelial Growth Factor-Related Protein; VRP; VEGF-C; Flt4 Ligand; Flt4-L; FLT4 Ligand DHM; LMPH1D; LMPHM4
-
AA Sequence
TEETIKFAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR
-
Predicted Molecular Mass
17.1 kDa
-
Molecular Weight
Approximately 23-30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of 50 mM MES, 150 mM NaCl, pH 6.0. Normally 5-8% trehalose is added as protectant before lyophilization.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)