ZBP1 Protein, Human (His)

2 Cited Publications
Customer Review

Based on 2 publication(s) in Google Scholar

ZBP1 is an important innate sensor that defends against viruses by recognizing Z-RNA structures and inducing PANoptosis. It binds Z-RNA through TNF-α family members and stimulates RIPK3 and MLKL to activate necroptosis. ZBP1 Protein, Human (His) is the recombinant human-derived ZBP1 protein, expressed by E. coli , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

ZBP1 is an important innate sensor that defends against viruses by recognizing Z-RNA structures and inducing PANoptosis. It binds Z-RNA through TNF-α family members and stimulates RIPK3 and MLKL to activate necroptosis. ZBP1 Protein, Human (His) is the recombinant human-derived ZBP1 protein, expressed by E. coli , with C-6*His labeled tag.

Background

ZBP1, a pivotal innate sensor, plays a crucial role in host defense against various viruses by recognizing and binding to Z-RNA structures produced by pathogens such as herpesvirus, orthomyxovirus, and flavivirus. This recognition triggers a spectrum of cell death responses, including pyroptosis, necroptosis, and apoptosis, collectively referred to as PANoptosis. ZBP1 serves as a key activator of necroptosis, particularly in response to death-inducing TNF-alpha family members, by binding Z-RNA and subsequently stimulating RIPK3 kinase, leading to the phosphorylation and activation of MLKL, ultimately executing programmed necrosis. Moreover, in the context of orthomyxovirus infection, ZBP1 detects Z-RNA structures in infected nuclei, activating RIPK3 and promoting MLKL phosphorylation, resulting in the disruption of the nuclear envelope and release of cellular DNA into the cytosol. ZBP1's role extends beyond direct pathogen sensing, as it is involved in PANoptosis triggered by bacterial and fungal infections. Notably, in response to Zika virus infection, ZBP1, in conjunction with RIPK3, initiates a death-independent transcriptional program that restricts viral replication by modifying cellular metabolism. However, in the case of herpes simplex virus 1 (HHV-1) infection, ZBP1 may form hetero-amyloid structures with HHV-1 protein RIR1/ICP6, potentially inhibiting ZBP1-mediated necroptosis and allowing viral evasion of host cell death pathways.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 90%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • ZBP1 (M1-S149)
      Accession # Q9H171-1
    • 6*His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    ZBP1; Z-DNA Binding Protein 1; alias:C20orf183; DLM1; DAI; Tumor Stroma And Activated Macrophage Protein DLM-1; Z-DNA-Binding Protein 1; DLM-1; DNA-Dependent Activator Of IRFs; DJ718J7.3; DNA-Dependent Activator Of IFN-Regulatory Factors; Chromosome 20 Op

  • AA Sequence

    MAQAPADPGREGHLEQRILQVLTEAGSPVKLAQLVKECQAPKRELNQVLYRMKKELKVSLTSPATWCLGGTDPEGEGPAELALSSPAERPQQHAATIPETPGPQFSQQREEDIYRFLKDNGPQRALVIAQALGMRTAKDVNRDLYRMKS

  • Predicted Molecular Mass

    17.5 kDa

  • Molecular Weight

    Approximately 16-23 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00