ZBP1 Protein, Human (His)
Based on 2 publication(s) in Google Scholar
ZBP1 is an important innate sensor that defends against viruses by recognizing Z-RNA structures and inducing PANoptosis. It binds Z-RNA through TNF-α family members and stimulates RIPK3 and MLKL to activate necroptosis. ZBP1 Protein, Human (His) is the recombinant human-derived ZBP1 protein, expressed by E. coli , with C-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
ZBP1 is an important innate sensor that defends against viruses by recognizing Z-RNA structures and inducing PANoptosis. It binds Z-RNA through TNF-α family members and stimulates RIPK3 and MLKL to activate necroptosis. ZBP1 Protein, Human (His) is the recombinant human-derived ZBP1 protein, expressed by E. coli , with C-6*His labeled tag.
Background
ZBP1, a pivotal innate sensor, plays a crucial role in host defense against various viruses by recognizing and binding to Z-RNA structures produced by pathogens such as herpesvirus, orthomyxovirus, and flavivirus. This recognition triggers a spectrum of cell death responses, including pyroptosis, necroptosis, and apoptosis, collectively referred to as PANoptosis. ZBP1 serves as a key activator of necroptosis, particularly in response to death-inducing TNF-alpha family members, by binding Z-RNA and subsequently stimulating RIPK3 kinase, leading to the phosphorylation and activation of MLKL, ultimately executing programmed necrosis. Moreover, in the context of orthomyxovirus infection, ZBP1 detects Z-RNA structures in infected nuclei, activating RIPK3 and promoting MLKL phosphorylation, resulting in the disruption of the nuclear envelope and release of cellular DNA into the cytosol. ZBP1's role extends beyond direct pathogen sensing, as it is involved in PANoptosis triggered by bacterial and fungal infections. Notably, in response to Zika virus infection, ZBP1, in conjunction with RIPK3, initiates a death-independent transcriptional program that restricts viral replication by modifying cellular metabolism. However, in the case of herpes simplex virus 1 (HHV-1) infection, ZBP1 may form hetero-amyloid structures with HHV-1 protein RIR1/ICP6, potentially inhibiting ZBP1-mediated necroptosis and allowing viral evasion of host cell death pathways.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Publications (2)
-
Journal Impact Factor
-
Most Recent
-
Phytomedicine
Modified Ganlu Xiaodu decoction attenuates airway barrier injury in Mycoplasma pneumoniae pneumonia by inhibiting ZBP1-mediated PANoptosis. [Abstract]2026 Jun:155:158112. PMID: 41936172 -
Adv Healthc Mater
Adaptable Covalent Organic Framework-Hydrogel Microneedles for Glucose-Responsive Isoliquiritigenin Delivery in Diabetic Wound Therapy. [Abstract]2026 Jul;15(26):e71343. PMID: 42277632
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-6*His
-
Accession
Q9H171-1 (M1-S149)
-
Molecular Construction
-
N-term
-
ZBP1 (M1-S149)
Accession # Q9H171-1 -
6*His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
ZBP1; Z-DNA Binding Protein 1; alias:C20orf183; DLM1; DAI; Tumor Stroma And Activated Macrophage Protein DLM-1; Z-DNA-Binding Protein 1; DLM-1; DNA-Dependent Activator Of IRFs; DJ718J7.3; DNA-Dependent Activator Of IFN-Regulatory Factors; Chromosome 20 Op
-
AA Sequence
MAQAPADPGREGHLEQRILQVLTEAGSPVKLAQLVKECQAPKRELNQVLYRMKKELKVSLTSPATWCLGGTDPEGEGPAELALSSPAERPQQHAATIPETPGPQFSQQREEDIYRFLKDNGPQRALVIAQALGMRTAKDVNRDLYRMKS
-
Predicted Molecular Mass
17.5 kDa
-
Molecular Weight
Approximately 16-23 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)