FITC-Ahx-β-Amyloid (1-42), (rat/mouse) tris
Based on 1 Customer Validation
FITC-Ahx-β-Amyloid (1-42), (rat/mouse) (tris) (FITC-Ahx-Amyloid β-peptide (1-42) (rat/mouse) (tris)) is a fluorescently labeled (FITC) form of β-Amyloid (1-42), (rat/mouse) (HY-P1388), which can be used in Alzheimer's disease-related research, such as aggregation, fiber formation, cellular uptake or imaging experiments. This product is provided in the form of Tris salt.
For research use only. We do not sell to patients.
- Purity : 95.59%
- Formula: C226H329N55O65S2·xC4H11NO3
- Molecular Weight:4920.49 (free base)
-
Storage:
Sealed storage, away from moisture.
Powder -80°C, 2 years , -20°C, 1 year* In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Biological Activity
Description
Chemical Information
-
Appearance Solid
-
Molecular Weight 4920.49 (free base)
-
Formula C226H329N55O65S2·xC4H11NO3
-
Color Light yellow to light brown
-
Synonyms
FITC-Ahx-Amyloid β-peptide (1-42) (rat/mouse) tris
-
Sequence
{FITC-Ahx}-Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala
-
Sequence Shortening
{FITC-Ahx}-DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Sealed storage, away from moisture
Powder -80°C 2 years -20°C 1 year * In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)
Purity & Documentation
-
Data Sheet (260 KB)
-
SDS (254 KB)
- English - EN (254 KB)
- Français - FR (254 KB)
- Deutsch - DE (254 KB)
- Norwegian - NO (254 KB)
- Español - ES (254 KB)
- Swedish - SV (254 KB)
- Italian - IT (254 KB)
- Korean - KR (254 KB)
- Portuguese - PT (254 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)