2. Neuronal Signaling
  3. Amyloid-β
  4. FITC-Ahx-β-Amyloid (1-42), (rat/mouse) tris

FITC-Ahx-β-Amyloid (1-42), (rat/mouse) tris  (Synonyms: FITC-Ahx-Amyloid β-peptide (1-42) (rat/mouse) tris)

Cat. No.: HY-P1388F
SDS
Handling Instructions Technical Support

FITC-Ahx-β-Amyloid (1-42), (rat/mouse) (tris) is a fluorescently labeled (FITC) form of β-Amyloid (1-42), (rat/mouse) (HY-P1388), which can be used in Alzheimer's disease-related research, such as aggregation, fiber formation, cellular uptake or imaging experiments. This product is provided in the form of Tris salt.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

FITC-Ahx-β-Amyloid (1-42), (rat/mouse) tris

FITC-Ahx-β-Amyloid (1-42), (rat/mouse) tris Chemical Structure

Size Price Stock Quantity
1 mg In-stock
5 mg In-stock
10 mg   Get quote  
50 mg   Get quote  

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Customer Review

Based on 1 Customer Validation

FITC-Ahx-β-Amyloid (1-42), (rat/mouse) tris Related Antibodies

Top Publications Citing Use of Products

  • Biological Activity

  • Purity & Documentation

  • Customer Review

Description

FITC-Ahx-β-Amyloid (1-42), (rat/mouse) (tris) is a fluorescently labeled (FITC) form of β-Amyloid (1-42), (rat/mouse) (HY-P1388), which can be used in Alzheimer's disease-related research, such as aggregation, fiber formation, cellular uptake or imaging experiments. This product is provided in the form of Tris salt.

Molecular Weight

4920.49 (free base)

Formula

C226H329N55O65S2·xC4H11NO3
Appearance

Solid

Sequence

{FITC-Ahx}-Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala
Sequence Shortening

{FITC-Ahx}-DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Purity & Documentation
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.

FITC-Ahx-β-Amyloid (1-42), (rat/mouse) tris Related Classifications

  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

FITC-Ahx-β-Amyloid (1-42), (rat/mouse)FITC-Ahx-Amyloid β-peptide (1-42) (rat/mouse)Amyloid-ββ-amyloid peptideAβAbetaInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FITC-Ahx-β-Amyloid (1-42), (rat/mouse) tris
Cat. No.:
HY-P1388F
Quantity:
MCE Japan Authorized Agent:

Customer Review

Thank You for Your Feedback!

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Email Address *

Phone Number

 

Department *

Organization Name *

 

Country or Region *

Remarks

SAFETY DATA SHEET (SDS)

Français - FR (252 KB) Deutsch - DE (252 KB) Norwegian - NO (252 KB) Español - ES (252 KB) Swedish - SV (252 KB) Italian - IT (252 KB) Korean - KR (252 KB) Portuguese - PT (252 KB)

Request for HNMR Report

We have received your request and will respond to you as soon as possible.