Stromatoxin 1
Stromatoxin 1 is an inhibitor of Potassium Channel, a peptide which can be isolated from tarantulas. Stromatoxin 1 selectively inhibits K(V)2.1, K(V)2.2, K(V)4.2, and K(V)2.1/9.3 channels. K(V)2.1 and K(V)2.2, but not K(V)4.2, channel subunits play a key role in opposing both myogenic and neurogenic urinary bladder smooth muscle (UBSM) contractions in rats.
연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.
- CAS No.: 741738-59-0
- 화학식: C156H237N49O48S7
- 분자량:3791.31
-
보관:
Please store the product under the recommended conditions in the Certificate of Analysis.
Biological Activity
K(V)2.1, K(V)2.2, K(V)4.2, and K(V)2.1/9.3[1]
Chemical Information
-
CAS No. 741738-59-0
-
분자량 3791.31
-
화학식 C156H237N49O48S7
-
Sequence
Asp-Cys-Thr-Arg-Met-Phe-Gly-Ala-Cys-Arg-Arg-Asp-Ser-Asp-Cys-Cys-Pro-His-Leu-Gly-Cys-Lys-Pro-Thr-Ser-Lys-Tyr-Cys-Ala-Trp-Asp-Gly-Thr-Ile-NH2 (Disulfide bridge: Cys2-Cys16, Cys9-Cys21, Cys15-Cys28)
-
Sequence Shortening
DCTRMFGACRRDSDCCPHLGCKPTSKYCAWDGTI-NH2 (Disulfide bridge: Cys2-Cys16, Cys9-Cys21, Cys15-Cys28)
-
선적
Room temperature in continental US; may vary elsewhere.
-
보관
Please store the product under the recommended conditions in the Certificate of Analysis.
순도&문서
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)