Neuromedin (B-30)
Neuromedin B-30 is the neuropeptide, which is orignally isolated from porcine brain and spinal cord. , and may exhibit activity in stimulating smooth-muscle. Neuromedin B causes local vasodilation, increases vascular permeability and local hyperalgesia, thereby participating in neurogenic inflammation. Neuromedin B regulates appetite, body temperature, and behavioral responses to stress. Neuromedin B is also involved in regulating smooth muscle contraction and secretory function in the gastrointestinal tract.
For research use only. We do not sell to patients.
- CAS No.: 98537-35-0
- Formula: C157H243N51O38S
- Molecular Weight:3484.99
-
Storage:
Please store the product under the recommended conditions in the Certificate of Analysis.
Biological Activity
Chemical Information
-
CAS No. 98537-35-0
-
Molecular Weight 3484.99
-
Formula C157H243N51O38S
-
Sequence
Leu-Ser-Trp-Asp-Leu-Pro-Glu-Pro-Arg-Ser-Arg-Ala-Gly-Lys-Ile-Arg-Val-His-Pro-Arg-Gly-Asn-Leu-Trp-Ala-Thr-Gly-His-Phe-Met-NH2
-
Sequence Shortening
LSWDLPEPRSRAGKIRVHPRGNLWATGHFM-NH2
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Please store the product under the recommended conditions in the Certificate of Analysis.
Purity & Documentation
References
[1]. Minamino N, et al., Neuromedins: novel smooth-muscle stimulating peptides identified in porcine spinal cord. Peptides. 1985;6 Suppl 3:245-8. [Content Brief]
[2]. Minamino N, et al., Neuromedin B-32 and B-30: two "big" neuromedin B identified in porcine brain and spinal cord. Biochem Biophys Res Commun. 1985 Jul 31;130(2):685-91. [Content Brief]
[3]. Mishra SK, et al., A nociceptive signaling role for neuromedin B. J Neurosci. 2012 Jun 20;32(25):8686-95. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)