Palopegteriparatide
Palopegteriparatide (Transcon PTH) is a prodrug of parathyroid hormone PTH 1-34, which can maintain normal and stable calcium concentrations without the need for calcium and active vitamin D replacement. Palopegteriparatide can be used in research on hypoparathyroidism.
For research use only. We do not sell to patients.
- CAS No.: 2222514-07-8
-
Storage:
Please store the product under the recommended conditions in the Certificate of Analysis.
Biological Activity
Description
Clinical Trial
| NCT Number | Sponsor | Condition | Start Date |
Phase
|
|---|---|---|---|---|
| NCT01329991 | Plexxikon| | 2011-05 | PHASE1 |
Chemical Information
-
CAS No. 2222514-07-8
-
Synonyms
Transcon PTH; ACP-014
-
Sequence
{X}-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe (X= O-methylpolyethylene glycol (2 x 20 kDa mPEG)-Aib)
-
Sequence Shortening
{X}-SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF (X= O-methylpolyethylene glycol (2 x 20 kDa mPEG)-Aib)
-
Shipping
Room temperature in continental US; may vary elsewhere.
-
Storage
Please store the product under the recommended conditions in the Certificate of Analysis.
Protocols
-
Research Protocol for Endocrine Diseases
Endocrine diseases often arise from disrupted hormone production, hormone signaling, or target-tissue responsiveness; for diabetes-focused endocrine disease models, insulin signaling regulates glucose uptake, hepatic glucose output, lipid metabolism, and β-cell compensation. Type 2 diabetes develops through interacting defects in insulin resistance, β-cell dysfunction, adipose inflammation, hepatic glucose overproduction, altered incretin signaling, and ectopic lipid metabolism. A major unresolved question is whether endocrine dysfunction is driven primarily by target-tissue insulin resistance, intrinsic β-cell failure, immune/inflammatory stress, or combined multi-organ failure that differs by disease stage.
Purity & Documentation
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)