14-3-3 theta Protein, Human (GST)

14-3-3 theta proteins are adapters in multiple signaling pathways that recognize phosphoserine or phosphothreonine motifs and modulate chaperone activity upon binding. It negatively regulates PDPK1 kinase activity, forms homodimers, and interacts with CDK16, phosphorylated RGS7, SSH1, phosphorylated CDKN1B, GAB2, phosphorylated PDPK1, and phosphorylated DAPK2. 14-3-3 theta Protein, Human (GST) is the recombinant human-derived 14-3-3 theta protein, expressed by E. coli , with N-GST labeled tag.

The 14-3-3 theta protein functions as an adapter implicated in the regulation of a diverse array of both general and specialized signaling pathways, engaging with numerous partners through the recognition of phosphoserine or phosphothreonine motifs. This binding typically results in the modulation of the activity of the interacting partner. Notably, 14-3-3 theta negatively regulates the kinase activity of PDPK1 and forms homodimers. It interacts with CDK16, RGS7 in its phosphorylated form, SSH1, CDKN1B in its 'Thr-198' phosphorylated form, GAB2, the 'Ser-241' phosphorylated form of PDPK1, and the 'Thr-369' phosphorylated form of DAPK2. Additionally, 14-3-3 theta interacts with PI4KB, TBC1D22A, TBC1D22B, SLITRK1, RIPOR2 isoform 2, INAVA (increasing upon pattern recognition receptor stimulation), MARK2, MARK3, MARK4, and MEFV. These interactions underscore the versatile role of 14-3-3 theta in various cellular processes and signaling pathways.

Human

E. coli

N-GST

P27348 (M1-N245)

10971  [NCBI]

Full Length

MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN

Approximately 53 kDa, based on SDS-PAGE under reducing conditions.

≥ 85%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.