1. Recombinant Proteins
  2. Acyl-protein thioesterase 2/LYPLA2 Protein, Human (His)

Acyl-protein thioesterase 2/LYPLA2 Protein, Human (His)

Cat. No.: HY-P70221
Handling Instructions

Acyl-protein thioesterase 2/LYPLA2 Protein, Human (His) a protein palmitoyl thioesterase, is a cytosolic enzyme that catalyze depalmitoylation of membrane-anchored, growth-associated protein-43 (GAP-43).

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock
10 μg $110 Ask For Quote & Lead Time
50 μg $330 Ask For Quote & Lead Time

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
rHuAcyl-protein thioesterase 2/LYPLA2, His; Acyl-Protein Thioesterase 2; APT-2; Lysophospholipase II; LPL-II; LysoPLA II; LYPLA2; APT2
Species

Human

Source

E. coli

Accession

O95372 (M1-V231)

Gene ID

11313

Molecular Weight

Approximately 28.0 kDa

AA Sequence

MCGNTMSVPLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLPHVKYICPHAPRIPVTLNMKMVMPSWFDLMGLSPDAPEDEAGIKKAAENIKALIEHEMKNGIPANRIVLGGFSQGGALSLYTALTCPHPLAGIVALSCWLPLHRAFPQAANGSAKDLAILQCHGELDPMVPVRFGALTAEKLRSVVTPARVQFKTYPGVMHSSCPQEMAAVKEFLEKLLPPV

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Biological Activity
Data is not available.
Appearance

Solution

Formulation

Supplied as a 0.2 μm filtered solution of 20 mM Tris, 1 mM DTT, 0.1 M NaCl, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C. It is stable at -20℃ for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Background

In mammals, palmitoylation is catalyzed by a family of 23 enzymes called palmitoyl acyltransferases (PATs)3,/sup>, whereas depalmitoylation is catalyzed by four thioesterases. Two of these thioesterases, acyl-protein thioesterase-1 (APT1) and APT2, are localized predominantly in the cytoplasm, and the other two, palmitoyl-protein thioesterase-1 (PPT1) and PPT2, are lysosomal enzymes. Acyl-protein thioesterase 2 (APT2), has been reported to depalmitoylate GAP-43 (growth-associated protein 43)[1].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Acyl-protein thioesterase 2/LYPLA2 Protein, Human (His)
Cat. No.:
HY-P70221
Quantity:
MCE Japan Authorized Agent: