Acyl-protein thioesterase 2/LYPLA2 Protein, Human (His)
Based on 1 Customer Validation
Acyl-protein thioesterase 2/LYPLA2 Protein, Human (His) a protein palmitoyl thioesterase, is a cytosolic enzyme that catalyze depalmitoylation of membrane-anchored, growth-associated protein-43 (GAP-43).
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
Acyl-protein thioesterase 2/LYPLA2 Protein, Human (His) a protein palmitoyl thioesterase, is a cytosolic enzyme that catalyze depalmitoylation of membrane-anchored, growth-associated protein-43 (GAP-43).
Background
In mammals, palmitoylation is catalyzed by a family of 23 enzymes called palmitoyl acyltransferases (PATs)3, whereas depalmitoylation is catalyzed by four thioesterases. Two of these thioesterases, acyl-protein thioesterase-1 (APT1) and APT2, are localized predominantly in the cytoplasm, and the other two, palmitoyl-protein thioesterase-1 (PPT1) and PPT2, are lysosomal enzymes. Acyl-protein thioesterase 2 (APT2), has been reported to depalmitoylate GAP-43 (growth-associated protein 43)[1].
Verified Bioactivity
The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-6*His
-
Accession
O95372 (M1-V231)
-
Molecular Construction
-
N-term
-
LYPA2 (M1-V231)
Accession # O95372 -
6*His
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
LYPLA2; APT2; Lysophospholipase 2; LysoPLA II; APT-2; LPL-II; Acyl-Protein Thioesterase 2; Testicular Tissue Protein Li 3; Palmitoyl-Protein Hydrolase; DJ886K2.4; Lysophospholipase II
-
AA Sequence
MCGNTMSVPLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLPHVKYICPHAPRIPVTLNMKMVMPSWFDLMGLSPDAPEDEAGIKKAAENIKALIEHEMKNGIPANRIVLGGFSQGGALSLYTALTCPHPLAGIVALSCWLPLHRAFPQAANGSAKDLAILQCHGELDPMVPVRFGALTAEKLRSVVTPARVQFKTYPGVMHSSCPQEMAAVKEFLEKLLPPV
-
Predicted Molecular Mass
25.8 kDa
-
Molecular Weight
Approximately 28 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 20 mM Tris, 1 mM DTT, 0.1 M NaCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (262 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
