1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Interleukin & Receptors
  4. IL-12 IL-23
  5. IL-12 beta
  6. Animal-Free IL-12 beta Protein, Mouse (His)

Animal-Free IL-12 beta Protein, Mouse (His)

Art. -Nr.: HY-P700191AF
Handling Instructions Technical Support

IL-12 beta protein is a cytokine that acts as a growth factor for activated T cells and NK cells, enhances lytic activity and stimulates IFN-γ production. It combines with IL23A to form IL-23, a cytokine critical in innate and adaptive immunity. Animal-Free IL-12 beta Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-12 beta protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Größe Preis Verfügbarkeit Menge
Kostenlose Probe   Apply now
Kostenlose Probe   Apply now
2 μg Auf Lager
10 μg Auf Lager
50 μg Auf Lager
100 μg   Angebot einholen  

* Bitte wählen Sie Menge, bevor Sie Artikel hinzufügen.

Top Publications Citing Use of Products
  • Biologische Aktivität

  • Technical Parameters

  • Properties

  • Beschreibung

  • Verweise

Beschreibung

IL-12 beta protein is a cytokine that acts as a growth factor for activated T cells and NK cells, enhances lytic activity and stimulates IFN-γ production. It combines with IL23A to form IL-23, a cytokine critical in innate and adaptive immunity. Animal-Free IL-12 beta Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-12 beta protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Background

The IL-12 beta Protein, a cytokine, functions as a growth factor for activated T and NK cells, enhancing the lytic activity of NK/lymphokine-activated killer cells and stimulating the production of IFN-gamma by resting PBMC. Furthermore, it associates with IL23A to form the IL-23 interleukin, a heterodimeric cytokine that plays a crucial role in both innate and adaptive immunity. IL-23, when bound to a heterodimeric receptor complex composed of IL12RB1 and IL23R, activates the Jak-Stat signaling cascade, preferentially stimulating memory T-cells over naive T-cells and promoting the production of pro-inflammatory cytokines. This interleukin may constitute, along with IL-17, an acute response to infection in peripheral tissues. However, IL-23's involvement extends to inducing autoimmune inflammation, potentially contributing to autoimmune inflammatory diseases, and it may play a significant role in tumorigenesis.

Biologische Aktivität

Measure by its ability to induce proliferation in T-cell enriched PBMC. The ED50 for this effect is <0.3 ng/mL.

Species

Mouse

Source

E. coli

Tag

C-6*His

Accession

P43432 (M23-S335)

Gene ID
Molecular Construction
N-term
IL-12β (M23-S335)
Accession # P43432
6*His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Interleukin-12 subunit beta; IL-12 subunit p40; IL-12B; Cytotoxic Lymphocyte Maturation Factor 40 kDa subunit (CLMF p40); NK cell Stimulating Factor Chain 2
AA Sequence

MWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRS

Predicted Molecular Mass
36.6 kDa
Molekulargewicht

Approximately 35-48 kDa, based on SDS-PAGE under reducing conditions.

Reinheit

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Versand

Room temperature in continental US; may vary elsewhere.

Dokumentation
Verweise
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Ihre kürzlich angesehenen Produkte:

Online-Anfrage

Your information is safe with us. * Required Fields.

Animal-Free IL-12 beta Protein, Mouse (His)

 

Requested Quantity *

Name des Antragstellers *

 

Anrede

E-Mail-Addresse *

 

Telefonnummer *

Department

 

Name der Organisation *

City

Bundesland

Country or Region *

     

Bemerkungen

Massenanfrage

Inquiry Information

Produktname:
Animal-Free IL-12 beta Protein, Mouse (His)
Art. -Nr.:
HY-P700191AF
Menge:
MCE Japan Authorized Agent: