Animal-Free IL-12 beta Protein, Mouse (His)
Based on 1 Customer Validation
IL-12 beta protein is a cytokine that acts as a growth factor for activated T cells and NK cells, enhances lytic activity and stimulates IFN-γ production. It combines with IL23A to form IL-23, a cytokine critical in innate and adaptive immunity. Animal-Free IL-12 beta Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-12 beta protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
IL-12 beta protein is a cytokine that acts as a growth factor for activated T cells and NK cells, enhances lytic activity and stimulates IFN-γ production. It combines with IL23A to form IL-23, a cytokine critical in innate and adaptive immunity. Animal-Free IL-12 beta Protein, Mouse (His) is the recombinant mouse-derived animal-FreeIL-12 beta protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.
Background
The IL-12 beta Protein, a cytokine, functions as a growth factor for activated T and NK cells, enhancing the lytic activity of NK/lymphokine-activated killer cells and stimulating the production of IFN-gamma by resting PBMC. Furthermore, it associates with IL23A to form the IL-23 interleukin, a heterodimeric cytokine that plays a crucial role in both innate and adaptive immunity. IL-23, when bound to a heterodimeric receptor complex composed of IL12RB1 and IL23R, activates the Jak-Stat signaling cascade, preferentially stimulating memory T-cells over naive T-cells and promoting the production of pro-inflammatory cytokines. This interleukin may constitute, along with IL-17, an acute response to infection in peripheral tissues. However, IL-23's involvement extends to inducing autoimmune inflammation, potentially contributing to autoimmune inflammatory diseases, and it may play a significant role in tumorigenesis.
Verified Bioactivity
Measure by its ability to induce proliferation in T-cell enriched PBMC. The ED50 for this effect is <0.3 ng/mL.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag C-6*His
-
Accession
P43432 (M23-S335)
-
Molecular Construction
-
N-term
-
IL-12β (M23-S335)
Accession # P43432 -
6*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
IL12B; Interleukin-12 Subunit Beta; Prev. NKSF2; Interleukin 12, P40; IL-12B; IL12, Subunit P40; CLMF2; IL-12 Subunit P40; NKSF; CLMF P40; CLMF; Cytotoxic Lymphocyte Maturation Factor 2, P40; Interleukin 12B (Natural Killer Cell Stimulatory Factor 2, Cyto
-
AA Sequence
MWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRS
-
Predicted Molecular Mass
36.6 kDa
-
Molecular Weight
Approximately 35-48 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, trehalose.
<0.1 EU per 1 μg of the protein by the LAL method.
It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
