Copy Link Print Information

Animal-Free M-CSF Protein, Human (His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

The M-CSF protein regulates macrophage production, differentiation, and function. It exists as an active disulfide-linked homodimer outside of cells, generated through proteolytic cleavage. It may also play a role in placental development. Alternative splicing produces multiple transcript variants. M-CSF is widely expressed in tissues such as placenta, spleen, and 25 other tissues. Animal-Free M-CSF Protein, Human (His) is the recombinant human-derived animal-FreeM-CSF protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Animal-Free M-CSF Protein, Human (His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The M-CSF protein regulates macrophage production, differentiation, and function. It exists as an active disulfide-linked homodimer outside of cells, generated through proteolytic cleavage. It may also play a role in placental development. Alternative splicing produces multiple transcript variants. M-CSF is widely expressed in tissues such as placenta, spleen, and 25 other tissues. Animal-Free M-CSF Protein, Human (His) is the recombinant human-derived animal-FreeM-CSF protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Background

The M-CSF protein is a cytokine that plays a key role in regulating the production, differentiation, and function of macrophages. It exists in an active form as a disulfide-linked homodimer, which is found outside of cells. This active form is believed to be generated through the proteolytic cleavage of membrane-bound precursors. Additionally, this protein may be involved in the development of the placenta. Alternative splicing gives rise to multiple transcript variants. The M-CSF protein exhibits widespread expression in various tissues, including the placenta (RPKM 19.9), spleen (RPKM 19.7), and 25 other tissues.

Verified Bioactivity

Measure by its ability to induce proliferation in NFS-60 cells. The ED50 for this effect is <1 ng/mL. The specific activity of recombinant human M-CSF is approximately >2.5x108 IU/mg.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag C-6*His
  • Accession

    NP_757350.2 (E33-S190)

  • Gene ID
    1435  [NCBI]
  • Molecular Construction
    • N-term
    • M-CSF (E33-S190)
      Accession # NP_757350.2
    • 6*His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    CSF1; Macrophage Colony Stimulating Factor 1; Colony Stimulating Factor 1; Lanimostim; MCSF; MGC31930; Proteoglycan Macrophage Colony-Stimulating Factor; PG-M-CSF; Macrophage Colony-Stimulating Factor 1; CSF-1; M-CSF; CSF1-HERV-LTR71B Fusion Protein; Colo

  • AA Sequence

    EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQGHERQSEGS

  • Predicted Molecular Mass

    13.3 kDa

  • Molecular Weight

    Approximately 13-26 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, trehalose.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • Animal-Free M-CSF Protein, Human (His) Product Image
    1/16
  • Animal-Free M-CSF Protein, Human (His) Product Image