Copy Link Print Information

Animal-Free TGF alpha/TGFA Protein, Human (His)

Customer Review

Based on 1 Customer Validation

TGF α/TGFA protein is a mitogenic polypeptide that binds to EGFR and acts synergistically with TGF β to promote anchorage-dependent cell proliferation. Its interaction with MAGI3, SDCBP, and the SNTA1 PDZ domain, especially with SDCBP, is critical for efficient cell surface targeting. Animal-Free TGF alpha/TGFA Protein, Human (His) is the recombinant human-derived animal-FreeTGF alpha/TGFA protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for Animal-Free TGF alpha/TGFA Protein, Human (His)
  • Experimental Validation Results for Animal-Free TGF alpha/TGFA Protein, Human (His)
  • Animal-Free TGF alpha/TGFA Protein, Human (His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

TGF α/TGFA protein is a mitogenic polypeptide that binds to EGFR and acts synergistically with TGF β to promote anchorage-dependent cell proliferation. Its interaction with MAGI3, SDCBP, and the SNTA1 PDZ domain, especially with SDCBP, is critical for efficient cell surface targeting. Animal-Free TGF alpha/TGFA Protein, Human (His) is the recombinant human-derived animal-FreeTGF alpha/TGFA protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Background

The TGF alpha/TGFA protein, a mitogenic polypeptide, demonstrates the capacity to bind to the EGF receptor/EGFR and synergistically acts with TGF beta, facilitating anchorage-independent cell proliferation in soft agar. This protein interacts with the PDZ domains of MAGI3, SDCBP, and SNTA1, with the association with SDCBP being crucial for effective targeting to the cell surface. In its immature form within the endoplasmic reticulum, characterized by a prosegment and lacking full N-glycosylation, TGF alpha/TGFA interacts with CNIH. Furthermore, in the Golgi apparatus, it may form a complex with CNIH and GORASP2. Additionally, through its cytoplasmic C-terminal domain, TGF alpha/TGFA interacts with NKD2, thereby exhibiting a spectrum of potential functional roles in diverse cellular compartments and interactions.

Verified Bioactivity

1.Measure by its ability to induce NIH/3T3 cells proliferation. The ED50 for this effect is <0.2 ng/mL. The specific activity of recombinant human TGF alpha is > 5 x 106 IU/mg.
2.Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 0.1 ng/mL, corresponding to a specific activity is 1.0×107 units/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 0.1 ng/mL, corresponding to a specific activity is 1.0×107 units/mg.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag C-6*His
  • Accession

    P01135 (V40-A89)

  • Gene ID
    7039  [NCBI]
  • Molecular Construction
    • N-term
    • TGF-α (V40-A89)
      Accession # P01135
    • 6*His
    • C-term
  • Protein Length

    Full Length of TGFA Chain

  • Synonyms

    TGFA; Transforming Growth Factor, Alpha; Transforming Growth Factor Alpha; TGF-Alpha; Protransforming Growth Factor Alpha; TFGA; Transforming Growth Factor, Alpha, Isoform CRA_d

  • AA Sequence

    VVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLA

  • Predicted Molecular Mass

    6.5 kDa

  • Molecular Weight

    Approximately 7 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 8.0, trehalose.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM sodium citrate, 0.2 M NaCl, pH 4.5.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<0.1 EU/μg, determined by LAL method.

Reconstitution

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 0.1 ng/mL, corresponding to a specific activity is 1.0×107 units/mg.

  • Animal-Free TGF alpha/TGFA Protein, Human (His) Product Image
    1/16
  • Experimental Validation Results for Animal-Free TGF alpha/TGFA Protein, Human (His)
  • Experimental Validation Results for Animal-Free TGF alpha/TGFA Protein, Human (His)
  • Animal-Free TGF alpha/TGFA Protein, Human (His) Product Image