ARF3 Protein, Human (His)
Based on 1 Customer Validation
ARF3 protein, a GTP-binding allosteric activator of cholera toxin, plays a role in protein trafficking and vesicle dynamics in the Golgi apparatus. Beyond toxin activation, ARF3 interacts with PRKCABP, participating in diverse cellular processes. It also associates with PI4KB and NCS1/FREQ at the Golgi complex, emphasizing its role in crucial molecular interactions for cellular functions. ARF3 Protein, Human (His) is the recombinant human-derived ARF3 protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
ARF3 protein, a GTP-binding allosteric activator of cholera toxin, plays a role in protein trafficking and vesicle dynamics in the Golgi apparatus. Beyond toxin activation, ARF3 interacts with PRKCABP, participating in diverse cellular processes. It also associates with PI4KB and NCS1/FREQ at the Golgi complex, emphasizing its role in crucial molecular interactions for cellular functions. ARF3 Protein, Human (His) is the recombinant human-derived ARF3 protein, expressed by E. coli , with N-His labeled tag.
ARF3, a GTP-binding protein, acts as an allosteric activator of the catalytic subunit of cholera toxin, an ADP-ribosyltransferase. Beyond its role in toxin activation, ARF3 is implicated in protein trafficking, exerting potential influence on vesicle budding and uncoating within the Golgi apparatus. This multifaceted protein interacts with PRKCABP, highlighting its involvement in various cellular processes. Additionally, ARF3 associates with PI4KB and NCS1/FREQ at the Golgi complex, further emphasizing its participation in molecular interactions crucial for cellular functions.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
P61204 (M1-K181)
-
Molecular Construction
-
N-term
-
His
-
ARF3 (M1-K181)
Accession # P61204 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
ARF3; Small GTP Binding Protein; ARF GTPase 3; ADP-Ribosylation Factor 3; ADP Ribosylation Factor 3
-
AA Sequence
MGNIFGNLLKSLIGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLANQLKNKK
-
Molecular Weight
Approximately 23 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris, 300 mM NaCl, 5% trehalose, 5% mannitol and 0.01% Tween 80, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
