1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. Arginase-1/ARG1 Protein, Human (HEK293, His)

Arginase-1/ARG1 Protein, Human (HEK293, His)

Cat. No.: HY-P7602
COA Handling Instructions

Arginase-1 Protein, Human (HEK293, His) expresses in HEK293 cells with a His tag at the C-terminus. Arginase-1 Protein inhibits the growth of the arginine-depleting enzyme arginine deiminase (ADI)-resistant Hep3B tumor cells in mice.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $200 In-stock
Estimated Time of Arrival: December 31
50 μg $600 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Arginase-1 Protein, Human (HEK293, His) expresses in HEK293 cells with a His tag at the C-terminus. Arginase-1 Protein inhibits the growth of the arginine-depleting enzyme arginine deiminase (ADI)-resistant Hep3B tumor cells in mice[1].

Background

Recombinant Human Arginase-1 has IC50s of 0.18 U/mL and 0.07 U/mL for HepG2 and Hep3B cells. Recombinant Human Arginase-1 has a Km value of 1.9 mM for arginine[1].

Biological Activity
Measured by the production of urea during the hydrolysis of arginine. The specific activity is 4.6 ×104 - 1.5 ×108pmol/min/µg.
Species

Human

Source

HEK293

Tag

C-6*His

Accession

P05089 (M1-K322)

Gene ID

383  [NCBI]

Synonyms
rHuArginase-1, His; ARG1; Arginase-1
AA Sequence

MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPKHHHHHH

Molecular Weight

Approximately 38.0 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE
Appearance

Solution

Formulation

Supplied as a 0.2 μm filtered solution of 20 mM Tris, 150 mM NaCl, 20%Glycerol, 1 mM DTT, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
References

Arginase-1/ARG1 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Active Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific active calculator equation

Specific Active (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Active (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Arginase-1/ARG1 Protein, Human (HEK293, His)
Cat. No.:
HY-P7602
Quantity:
MCE Japan Authorized Agent: