ASB13 Protein, Human (His)
ASB13 Protein, Human (His) belongs to the ankyrin repeat and SOCS box-containing (ASB) family of proteins, with an N-terminal His tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
ASB13 Protein, Human (His) belongs to the ankyrin repeat and SOCS box-containing (ASB) family of proteins, with an N-terminal His tag[1].
Ankyrin repeat and SOCS box protein 13 is a protein that in humans is encoded by the ASB13 gene. ASB13 contains ankyrin repeat sequence and a SOCS box domain. ASB13 plays a role as a substrate-recognition part of a stem cell factor (SCF)-like Elongin-Cullin-SOCS (ECS) E3 ubiquitin-protein ligase complex which arbitrates the ubiquitination and subsequent proteasomal degradation of target proteins[1].
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q8WXK3-1 (M1-N278)
-
Molecular Construction
-
N-term
-
6*His
-
ASB13 (M1-N278)
Accession # Q8WXK3-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
ASB13; MGC19879; Ankyrin Repeat And SOCS Box Containing 13; Ankyrin Repeat Domain-Containing SOCS Box Protein Asb-13; Ankyrin Repeat And SOCS Box Protein 13; Ankyrin Repeat And SOCS Box-Containing 13; FLJ13134; ASB-13
-
AA Sequence
MEPRAADGCFLGDVGFWVERTPVHEAAQRGESLQLQQLIESGACVNQVTVDSITPLHAASLQGQARCVQLLLAAGAQVDARNIDGSTPLCDACASGSIECVKLLLSYGAKVNPPLYTASPLHEACMSGSSECVRLLIDVGANLEAHDCHFGTPLHVACAREHLDCVKVLLNAGANVNAAKLHETALHHAAKVKNVDLIEMLIEFGGNIYARDNRGKKPSDYTWSSSAPAKCFEYYEKTPLTLSQLCRVNLRKATGVRGLEKIAKLNIPPRLIDYLSYN
-
Predicted Molecular Mass
31.4 kDa
-
Molecular Weight
Approximately 28 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 80%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
