BCMA/TNFRSF17 Protein, Human (Biotinylated, HEK293, His-Avi)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

B Cell Maturation Antigen (BCMA) also referred to as TNFRSF17 or CD269, is a transmembrane glycoprotein member of the tumor necrosis factor receptor (TNFR) superfamily. BCMA is used as a biomarker for Multiple myeloma (MM). BCMA mainly plays an important role in B cells for their proliferation, survival and also differentiates them into plasma cells. BCMA/TNFRSF17 Protein, Human (Biotinylated, HEK293, His-Avi) is a biotinylated recombinant protein with a C-Terminal Avi label and a C-Terminal His label, It consists of 54 amino acids (M1-A54) and is produced in HEK293 cells.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

B Cell Maturation Antigen (BCMA) also referred to as TNFRSF17 or CD269, is a transmembrane glycoprotein member of the tumor necrosis factor receptor (TNFR) superfamily. BCMA is used as a biomarker for Multiple myeloma (MM). BCMA mainly plays an important role in B cells for their proliferation, survival and also differentiates them into plasma cells[1]. BCMA/TNFRSF17 Protein, Human (Biotinylated, HEK293, His-Avi) is a biotinylated recombinant protein with a C-Terminal Avi label and a C-Terminal His label, It consists of 54 amino acids (M1-A54) and is produced in HEK293 cells.

Background

BCMA is expressed preferentially by mature B lymphocytes, with minimal expression in hematopoietic stem cells or nonhematopoietic tissue[1]. BCMA is almost exclusively expressed on plasmablasts and PCs[2].
The amino acid sequence of human BCMA protein has low homology for mouse BCMA protein.
BCMA is a 184 amino acid and 20.2-kDa type III transmembrane glycoprotein, with the extracellular N terminus containing a conserved motif of 6 cysteines. BCMA has two agonist ligands: a proliferation-inducing ligand (APRIL) and B cell activating factor (BAFF). Upon binding of the ligands to BCMA, activates B cells (NF-κβ), rat sarcoma/mitogen-activated protein kinase (RAS/MAPK), and phosphoinositide-3-kinase-protein kinase B/Akt (PI3K-PKB/Akt) signaling pathway. These pathways result in proliferation stimulation by modulating cell cycle checkpoints, increasing survival by upregulating anti-apoptotic proteins, and production of cell adhesion molecules, angiogenesis factors, and immunosuppressive molecules[2].
BCMA can be used as a promising antigen to target using a variety of immuno-therapy treatments including CART cells, for MM patients[3]. BCMA markedly reduces plasma IgA, IgG, and IgM levels and splenic Ig heavy chain mRNA levels in mouse[4]. In BCMA−/− mice, the long-term survival of PCs is impaired, but lack of BCMA has no effect in short-lived PCs, B cell development, or early humoral immune response, and the splenic architecture and germinal centers appear intact in these BCMA-deficient mice[5]. BCMA overexpression significantly promotes in vivo growth of xenografted MM cells in murine models[6].

In Vitro

BCMA (human; 10000 ng/mL; 24 h) blocks the activity of ARI2m cells and inhibits the IFNγ production[3].

In Vivo

BCMA (human; 100 µg; i.p.; on days -4, -2, 0, 2, and 4) decreases the IgA and IgM levels in C57 Bl/6 mice[4].

Verified Bioactivity

1. Immobilized Biotinylated Human BCMA His at 0.5 μg/mL (100μL/Well). Dose response curve for Anti-Human BCMA Ab hFc with the EC50 of 0.1-5.0 μg/mL determined by ELISA.
2. Immobilized Anti-BCMA Antibody at 0.2 μg/mL (100 μL/well) on the plate. Dose response curve for Biotinylated Human BCMA, His Tag with the EC50 of 2.4 ng/mL determined by ELISA.
3. Loaded Pamlectabart (HY-P991014) on AHC2 biosensor, can bind BCMA/TNFRSF17 Protein, Human (Biotinylated, HEK293, His-Avi) with an affinity constant of 4.442E-10 M as determined in BLI assay.

MCE Validation Data

  • Bioactivity - BLI

    Bioactivity - BLI

    Loaded Pamlectabart (HY-P991014) on AHC2 biosensor, can bind BCMA/TNFRSF17 Protein, Human (Biotinylated, HEK293, His-Avi) with an affinity constant of 4.442E-10 M as determined in BLI assay.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-Avi;C-8*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • BCMA (M1-A54)
      Accession # Q02223
    • 8*His-Avi
    • C-term
  • Protein Length

    Extracellular Domain

  • Conjugation

    Biotin

  • Conjugate Method

    The single lysine residue in Avitag is biotinylated through an enzymatic reaction.

  • Synonyms

    TNFRSF17; TNFRSF13A; Prev. BCMA; Tumor Necrosis Factor Receptor Superfamily, Member 17; BCM; B Cell Maturation Antigen; Tumor Necrosis Factor Receptor Superfamily Member 17; B-Cell Maturation Factor; B-Cell Maturation Protein; CD269 Antigen; TNF Receptor

  • AA Sequence

    MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA

  • Predicted Molecular Mass

    8.9 kDa

  • Molecular Weight

    Approximately 12-17 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00