BD-1 Protein, Rat
Based on 1 Customer Validation
BD-1 Protein, Rat is antimicrobial peptide that defends epithelial surfaces including the skin, gastrointestinal, and respiratory tracts.
- Species: Rat
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
BD-1 Protein, Rat is antimicrobial peptide that defends epithelial surfaces including the skin, gastrointestinal, and respiratory tracts.
Beta Defensin-1 displays potent microcidal properties, and also plays a part in other aspects of innate and adaptive immunity[1]. Rat Beta Defensin-1 reduction may be in part responsible for the high incidence of urinary tract infections in diabetes mellitus[2].
Measured by its anti-microbial activity against E. coli. The ED50 for this effect is 62.07 ng/mL, corresponding to a specific activity is 1.61×10^4 U/mg.
Technical Parameters
-
Species Rat
-
Source E. coli
-
Tag Tag Free
-
Accession
O89117 (D33-S69)
-
Molecular Construction
-
N-term
-
BD-1 (D33-S69)
Accession # O89117 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
DEFB1; DEFB-1; Defensin Beta 1; HBD-1; HBD1; Defensin, Beta 1; BD1; MGC51822; Beta-Defensin 1; BD-1; DEFB101; Beta Defensin 1
-
AA Sequence
DQYRCLQNGGFCLRSSCPSHTKLQGTCKPDKPNCCRS
-
Molecular Weight
Approximately 7 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (260 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
[1]. Semple F, et al. β-Defensins: multifunctional modulators of infection, inflammation and more? J Innate Immun. 2012;4(4):337-48. [Content Brief]
[2]. Hiratsuka T, et al. Nucleotide sequence and expression of rat beta-defensin-1: its significance in diabetic rodent models. Nephron. 2001 May;88(1):65-70. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
