1. Recombinant Proteins
  2. CD Antigens
  3. Dendritic Cell CD Proteins
  4. BST-2/CD317
  5. BST2 Protein, Cynomolgus (HEK293, His)

The BST2 protein is an IFN-induced antiviral factor that inhibits mammalian enveloped viruses by tethering viral particles to infected cell membranes. BST2 acts as a physical tether connecting virions, limiting their release and spread. BST2 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived BST2 protein, expressed by HEK293 , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg Get quote
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The BST2 protein is an IFN-induced antiviral factor that inhibits mammalian enveloped viruses by tethering viral particles to infected cell membranes. BST2 acts as a physical tether connecting virions, limiting their release and spread. BST2 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived BST2 protein, expressed by HEK293 , with N-His labeled tag.

Background

BST2 Protein, an IFN-induced antiviral host restriction factor, serves as a potent inhibitor of diverse mammalian enveloped viruses by directly tethering nascent virions to the membranes of infected cells. Functioning as a direct physical tether, BST2 holds virions to the cell membrane, facilitating their linkage to each other. This unique mechanism restrains the release of virions, which can be internalized by endocytosis and subsequently degraded, or remain on the cell surface, limiting their spread as cell-free virions. Targeting viruses from various families, including retroviridae (e.g., HIV-1, MMTV, MLV), filoviridae (e.g., EBOV), arenaviridae (e.g., LASV), and rhabdoviridae (e.g., VSV), BST2 demonstrates broad antiviral activity. Beyond its role in viral restriction, BST2 also inhibits the cell surface proteolytic activity of MMP14, leading to decreased activation of MMP15 and consequent inhibition of cell growth and migration. Additionally, BST2 can stimulate signaling by LILRA4/ILT7, providing negative feedback to the production of IFN by plasmacytoid dendritic cells in response to viral infection. Furthermore, BST2 contributes to the organization of the subapical actin cytoskeleton in polarized epithelial cells. Structurally, BST2 forms a parallel homodimer that is disulfide-linked, and its dimerization is essential for its antiviral activity. The protein interacts with ARHGAP44, MMP14, and LILRA4/ILT7, revealing its involvement in diverse cellular processes and signaling pathways.

Species

Cynomolgus

Source

HEK293

Tag

N-8*His

Accession

XP_005588438.1 (I49-S163)

Gene ID

/

Molecular Construction
N-term
8*His
BST2 (I49-S163)
Accession # XP_005588438.1
C-term
Protein Length

Partial

Synonyms
BST-2; HM1.24 antigen; CD317; BST2; NPC-A-7; PDCA-1; TETHERIN
AA Sequence

IKANSEACQDGLRAVMECRNVTYLLQQELAEAQRGFRDAEAQAVTCNQTVMALMASLDAEKAQGRKKVEELEGEITTLNHKLQDASAEVERLRRENHVLNARIADTDSASSQDSS

Molecular Weight

15-30 kDa

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

BST2 Protein, Cynomolgus (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

BST2 Protein, Cynomolgus (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
BST2 Protein, Cynomolgus (HEK293, His)
Cat. No.:
HY-P700667
Quantity:
MCE Japan Authorized Agent: